Text search

Apply filters

Catalogue

You can click on the

icon to view detailed product information.

Code	Name	Clone	Product family	Description	Species reactivity	Species reactivity text	Type	Application	Category	Labels
MUB0109P	actin α-cardiac	22D3	Cytoskeletal	The monoclonal antibody a-CAA, clone 22D3 is an antibody against the cardiac actin, the antibody is highly specific for cardiac actin, and does not cross react with the other actin isoforms. The immunogen was the synthetic cardiac actin N-terminal decapeptide conjugated o KLH.	Goat,Human,Rabbit,Rat,Swine,Zebrafish	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Immunohistochemistry frozen ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0109S	actin α-cardiac	22D3	Cytoskeletal	The monoclonal antibody a-CAA, clone 22D3 is an antibody against the cardiac actin, the antibody is highly specific for cardiac actin, and does not cross react with the other actin isoforms. The immunogen was the synthetic cardiac actin N-terminal decapeptide conjugated o KLH.	Goat,Human,Rabbit,Rat,Swine,Zebrafish	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Immunohistochemistry frozen ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0107S	actin α-muscle	HHF35	Cytoskeletal	HHF35 reacts with both α-muscle and γ−smooth muscle actin, and therefore reacts with skeletal muscle, cardiac muscle, vascular and visceral smooth muscle cells, pericytes ond epithelial cells. It is also reactive in myofibroblasts.	Chicken,Human,Monkey,Rabbit,Rat,Swine,Zebrafish	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Supernatant monoclonal antibody	Electron microscopy,Enzyme Linked Immuno Sorbent Assay,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0107P	actin α-muscle	HHF35	Cytoskeletal	HHF35 reacts with both α-muscle and γ−smooth muscle actin, and therefore reacts with skeletal muscle, cardiac muscle, vascular and visceral smooth muscle cells, pericytes ond epithelial cells. It is also reactive in myofibroblasts.	Chicken,Human,Monkey,Rabbit,Rat,Swine,Zebrafish	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Purified monoclonal antibody	Electron microscopy,Enzyme Linked Immuno Sorbent Assay,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0108S	actin α-skeletal	3B3	Cytoskeletal	The monoclonal antibody a-SKA, clone 3B3 is an antibody against alpha skeletal actin, the antibody is highly specific for alpha-skeletal actin and does not cross react with other actin isoforms. The immunogen was the synthetic skeletal actin N-terminal decapeptide conjugated to KLH.	Goat,Human,Rabbit,Rat,Swine	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0108P	actin α-skeletal	3B3	Cytoskeletal	The monoclonal antibody a-SKA, clone 3B3 is an antibody against alpha skeletal actin, the antibody is highly specific for alpha-skeletal actin and does not cross react with other actin isoforms. The immunogen was the synthetic skeletal actin N-terminal decapeptide conjugated to KLH.	Goat,Human,Rabbit,Rat,Swine	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0100P	actin α-smooth muscle	1A4	Cytoskeletal	α-SM1 reacts exclusively with α-smooth muscle actin which is typical for vascular and visceral smooth muscle cells, but which is also present in myofibroblasts. The epitope that is recognized by α-SM1 is Ac-EEED.	Chicken,Goat,Monkey,Quail,Rat,Sheep,Swine,Xenopus	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Purified monoclonal antibody	Electron microscopy,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0100S	actin α-smooth muscle	1A4	Cytoskeletal	α-SM1 reacts exclusively with α-smooth muscle actin which is typical for vascular and visceral smooth muscle cells, but which is also present in myofibroblasts. The epitope that is recognized by α-SM1 is Ac-EEED.	Chicken,Goat,Monkey,Quail,Rat,Sheep,Swine,Xenopus	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Supernatant monoclonal antibody	Electron microscopy,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0110P	actin β-cytoplasmic	4C2	Cytoskeletal	The monoclonal antibody Anti-b-CYA, clone 4C2 is an antibody against beta cytoplasmic actin, the antibody is highly specific for beta-cytoplasmic actin and does not cross react with other actin isoforms. The immunogen was the synthetic KLH-coupled peptide corresponding to the N-terminal nonapeptide of the b-cytoplasmic actin.	Chicken,Human,Mouse,Rabbit,Rat,Swine	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cytoskeleton,Stem cell research	None
MUB0110S	actin β-cytoplasmic	4C2	Cytoskeletal	The monoclonal antibody Anti-b-CYA, clone 4C2 is an antibody against beta cytoplasmic actin, the antibody is highly specific for beta-cytoplasmic actin and does not cross react with other actin isoforms. The immunogen was the synthetic KLH-coupled peptide corresponding to the N-terminal nonapeptide of the b-cytoplasmic actin.	Chicken,Human,Mouse,Rabbit,Rat,Swine	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cytoskeleton,Stem cell research	None
MUB0111S	actin γ-cytoplasmic	2A3	Cytoskeletal	The monoclonal antibody Anti-g-CYA, clone 2A3 is an antibody against gamma cytoplasmic actin, the antibody is highly specific for gamma-cytoplasmic actin and does not cross react with other actin isoforms. The immunogen was the synthetic KLH-coupled peptide corresponding to the N-terminal nonapeptide of the g-cytoplasmic actin.	Chicken,Human,Mouse,Rabbit,Rat,Swine,Zebrafish	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Supernatant monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cytoskeleton,Stem cell research	None
MUB0111P	actin γ-cytoplasmic	2A3	Cytoskeletal	The monoclonal antibody Anti-g-CYA, clone 2A3 is an antibody against gamma cytoplasmic actin, the antibody is highly specific for gamma-cytoplasmic actin and does not cross react with other actin isoforms. The immunogen was the synthetic KLH-coupled peptide corresponding to the N-terminal nonapeptide of the g-cytoplasmic actin.	Chicken,Human,Mouse,Rabbit,Rat,Swine,Zebrafish	The epitope recognized by α-SM1 is highly conserved. The antibody therefore cross-reacts with many species including protochordates, lower craniates and mammals.	Purified monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cytoskeleton,Stem cell research	None
MUB0106S	annexin V	RUU-WAC2A	Annexins	RUU-WAC2A reacts against human recombinant and endogenous annexin A5. It shows no cross reactivity with Annexins I, II, III, IV, VI, VII and VIII in ELISA or in immunoprecipitation. It does not recognise monkey and rat Annexin V in ELISA.	Human		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Immunocytochemistry,Immunofluorescence,Immunohistochemistry frozen ,Immunohistochemistry paraffin	Apoptosis	None
MUB0106P	annexin V	RUU-WAC2A	Annexins	RUU-WAC2A reacts against human recombinant and endogenous annexin A5. It shows no cross reactivity with Annexins I, II, III, IV, VI, VII and VIII in ELISA or in immunoprecipitation. It does not recognise monkey and rat Annexin V in ELISA.	Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Immunocytochemistry,Immunofluorescence,Immunohistochemistry frozen ,Immunohistochemistry paraffin	Apoptosis	None
MUB0312P	Basal cell cytokeratin	RCK103	Cytoskeletal	RCK103 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a mix of cell preparations containing human cytokeratins. This monoclonal antibody stains basal cells in combined and stratified epithelial tissues. It recognizes the stem cell population, including the so-called amplifying cells in the prostate epithelium.	Canine,Chicken,Guinea Pig,Hamster,Human,Quail,Rabbit,Rat		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cytoskeleton	None
MUB0312S	Basal cell cytokeratin	RCK103	Cytoskeletal	RCK103 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a mix of cell preparations containing human cytokeratins. This monoclonal antibody stains basal cells in combined and stratified epithelial tissues. It recognizes the stem cell population, including the so-called amplifying cells in the prostate epithelium.	Canine,Chicken,Guinea Pig,Hamster,Human,Quail,Rabbit,Rat		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cytoskeleton	None
MUB0202S	Bombesin	Polyclonal	Other		Chicken,Human,Rat		Unpurified polyclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB0200S	Bromodeoxyuridine / BrdU	IIB5	Cell cycle markers	IIB5 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse intraperitoneally immunized with BrdU conjugated to bovine serum albumin.	Not applicable		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin	Cancer,Cell cycle,Immunology,Neurobiology,Stem cell research	None
MUB0200P	Bromodeoxyuridine / BrdU	IIB5	Cell cycle markers	IIB5 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse intraperitoneally immunized with BrdU conjugated to bovine serum albumin.	Not applicable		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin	Cancer,Cell cycle,Immunology,Neurobiology,Stem cell research	None
MUB0203S	CA 125	Ov 185:1	Tumour marker		Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB0332P	Carcinoembryonic Antigen / CEA	PARLAM 4	Tumour marker	PARLAM 4 does not show cross reactivity with biliary glycoprotein (BGP) and non-specific cross-reacting antigen 1/11 (NCA). This differentiates PARLAM 4 from most polyclonal CEA antisera which do show cross-reactivity with related antigens such as (BGP) and (NCA). In immunoblotting PARLAM 4 recognizes a single band of 180 kD.	Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation	None
MUB0332S	Carcinoembryonic Antigen / CEA	PARLAM 4	Tumour marker	PARLAM 4 does not show cross reactivity with biliary glycoprotein (BGP) and non-specific cross-reacting antigen 1/11 (NCA). This differentiates PARLAM 4 from most polyclonal CEA antisera which do show cross-reactivity with related antigens such as (BGP) and (NCA). In immunoblotting PARLAM 4 recognizes a single band of 180 kD.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation	None
MUB2007S	Carcinoma ass. Antigen	175F4	Tumour marker		Human		Supernatant monoclonal antibody	Immunohistochemistry frozen		None
MUB2007P	Carcinoma ass. Antigen	175F4	Tumour marker		Human		Purified monoclonal antibody	Immunohistochemistry frozen		None
MUB0308S	Cardiotin	SR-2	Membrane	SR-2 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the 100 kDa cardiotin subunit. SR-2 reacts with cardiotin, a mitochondrion- associated protein, which is present in cardiomyocytes and skeletal muscle. SR-2 reacts with cardiomyocytes, skeletal muscle, stromal and epithelial cells as well in vivo as in vitro.	Human,Swine		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular	None
MUB0309P	Cardiotin	SR-3	Membrane	SR-3 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the 100 kDa cardiotin subunit. SR-3 reacts with cardiotin, a mitochondrion-associated protein, which is present in cardiomyocytes and skeletal muscle, but also in epithelial cells and tissues.	Human,Swine		Purified monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cardiovascular	None
MUB0310P	Cardiotin	SR-4	Membrane	SR-4 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with cardiotin. SR-4 reacts with cardiotin, a mitochondrion- associated protein, which is present in cardiomyocytes and skeletal muscle, but also in epithelial cells and tissues.	Human,Swine		Purified monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cardiovascular	None
MUB0307P	Cardiotin	R2G	Membrane	R2G is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells, with spleen cells from a mouse immunized with a total protein extract of chicken gizzard. R2G reacts with cardiotin, a mitochondrion- associated protein, which is present in cardiomyocytes and skeletal muscle.	Canine,Feline,Goat,Hamster,Human,Monkey,Mouse,Rabbit,Rat,Xenopus		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular	None
MUB0309S	Cardiotin	SR-3	Membrane	SR-3 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the 100 kDa cardiotin subunit. SR-3 reacts with cardiotin, a mitochondrion-associated protein, which is present in cardiomyocytes and skeletal muscle, but also in epithelial cells and tissues.	Human,Swine		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cardiovascular	None
MUB0307S	Cardiotin	R2G	Membrane	R2G is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells, with spleen cells from a mouse immunized with a total protein extract of chicken gizzard. R2G reacts with cardiotin, a mitochondrion- associated protein, which is present in cardiomyocytes and skeletal muscle.	Canine,Feline,Goat,Hamster,Human,Monkey,Mouse,Rabbit,Rat,Xenopus		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular	None
MUB0310S	Cardiotin	SR-4	Membrane	SR-4 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with cardiotin. SR-4 reacts with cardiotin, a mitochondrion- associated protein, which is present in cardiomyocytes and skeletal muscle, but also in epithelial cells and tissues.	Human,Swine		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cardiovascular	None
MUB0308P	Cardiotin	SR-2	Membrane	SR-2 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the 100 kDa cardiotin subunit. SR-2 reacts with cardiotin, a mitochondrion- associated protein, which is present in cardiomyocytes and skeletal muscle. SR-2 reacts with cardiomyocytes, skeletal muscle, stromal and epithelial cells as well in vivo as in vitro.	Human,Swine		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular	None
MUB3006P2	CD10	B-E3	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3006L1	CD10, labeled with Fluorescein Isothiocyanate	B-E3	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3006L5	CD10, labeled with Phycoerythrin	B-E3	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3006P3	CD10	B-E3	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3006P1	CD10	B-E3	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3030P3	CD103	B-ly7	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3030L1	CD103, labeled with Fluorescein Isothiocyanate	B-ly7	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3030L5	CD103, labeled with Phycoerythrin	B-ly7	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Phycoerythrin
MUB3030P2	CD103	B-ly7	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3030P1	CD103	B-ly7	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3030L9	CD103, labeled with Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5	B-ly7	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5
MUB3031L1	CD106, labeled with Fluorescein Isothiocyanate	B-K9	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3031P3	CD106	B-K9	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3031P1	CD106	B-K9	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3031P2	CD106	B-K9	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3007P2	CD11a	DF1524	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3007P3	CD11a	DF1524	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3007L5	CD11a, labeled with Phycoerythrin	DF1524	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3007P1	CD11a	DF1524	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB0375S	CD11a (inhibitor)	NKI(SPV)-L7	CD markers, Cell adhesion	The monoclonal antibody SPV-L7 reacts with the alpha chain of LFA-1, the CD11a/CD18 integrin heterodimer present on human T- and B-lymphocytes, granulocytes and monocytes. The antibody was obtained by immunisation of Balb/c mice with cells of the T4+T8- cytotoxic T lymphocyte clone HG-38. The antibody was selected for inhibition of T-cell mediated killing by screening of the hybridoma supernatants 10-14 days after the fusion.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunoprecipitation	Cell adhesion,Immunology	None
MUB0375P	CD11a (inhibitor)	NKI(SPV)-L7	CD markers, Cell adhesion	The monoclonal antibody SPV-L7 reacts with the alpha chain of LFA-1, the CD11a/CD18 integrin heterodimer present on human T- and B-lymphocytes, granulocytes and monocytes. The antibody was obtained by immunisation of Balb/c mice with cells of the T4+T8- cytotoxic T lymphocyte clone HG-38. The antibody was selected for inhibition of T-cell mediated killing by screening of the hybridoma supernatants 10-14 days after the fusion.	Human		Purified monoclonal antibody	Flow Cytometry,Immunoprecipitation	Cell adhesion,Immunology	None
MUB1111S	CD11a inhibitor	NKI(SPV)-L15	CD markers, Cell adhesion		Human		Supernatant monoclonal antibody	Flow Cytometry,Immunoprecipitation,Western blotting		None
MUB1111P	CD11a inhibitor	NKI(SPV)-L15	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunoprecipitation,Western blotting		None
MUB3032L7	CD138, labeled with Cyanine 5.18 and Phycoerythrin	B-A38	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry paraffin ,Western blotting		Cyanine 5.18 and Phycoerythrin
MUB3032P2	CD138	B-A38	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry paraffin ,Western blotting		None
MUB3032L1	CD138, labeled with Fluorescein Isothiocyanate	B-A38	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry paraffin ,Western blotting		Fluorescein Isothiocyanate
MUB3032P3	CD138	B-A38	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry paraffin ,Western blotting		None
MUB3032L6	CD138, labeled with Allephycocyanin	B-A38	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry paraffin ,Western blotting		Allephycocyanin
MUB3032P1	CD138	B-A38	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry paraffin ,Western blotting		None
MUB3032L9	CD138, labeled with Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5	B-A38	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry paraffin ,Western blotting		Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5
MUB3032L5	CD138, labeled with Phycoerythrin	B-A38	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry paraffin ,Western blotting		Phycoerythrin
MUB3008L5	CD15, labeled with Phycoerythrin	BRA-4F1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3008L1	CD15, labeled with Fluorescein Isothiocyanate	BRA-4F1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3008P2	CD15	BRA-4F1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3008P3	CD15	BRA-4F1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3008P1	CD15	BRA-4F1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3009P1	CD16	B-E16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3009P3	CD16	B-E16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3009L1	CD16, labeled with Fluorescein Isothiocyanate	B-E16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3009L5	CD16, labeled with Phycoerythrin	B-E16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3009P2	CD16	B-E16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3034P1	CD163	MAC2-48	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		None
MUB3033L5	CD163, labeled with Phycoerythrin	MAC2-158	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		Phycoerythrin
MUB3033P1	CD163	MAC2-158	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		None
MUB3034P3	CD163	MAC2-48	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		None
MUB3034P2	CD163	MAC2-48	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		None
MUB3033P2	CD163	MAC2-158	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		None
MUB3033L3	CD163, labeled with Allephycocyanin	MAC2-158	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		Allephycocyanin
MUB3034L5	CD163, labeled with Phycoerythrin	MAC2-48	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		Phycoerythrin
MUB3033P3	CD163	MAC2-158	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		None
MUB3033L1	CD163, labeled with Fluorescein Isothiocyanate	MAC2-158	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		Fluorescein Isothiocyanate
MUB3010L1	CD19, labeled with Fluorescein Isothiocyanate	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3010L8	CD19, labeled with Peridinin-Chlorophyll-Protein Complex	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Peridinin-Chlorophyll-Protein Complex
MUB3010P1	CD19	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3010P2	CD19	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3010L6	CD19, labeled with Allephycocyanin	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Allephycocyanin
MUB3010L7	CD19, labeled with Cyanine 5.18 and Phycoerythrin	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Cyanine 5.18 and Phycoerythrin
MUB3010L9	CD19, labeled with Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5
MUB3010L5	CD19, labeled with Phycoerythrin	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Phycoerythrin
MUB3010P3	CD19	HD37	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3000P1	CD1a	MCD1a	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3000L5	CD1a, labeled with Phycoerythrin	MCD1a	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3000P3	CD1a	MCD1a	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3000P2	CD1a	MCD1a	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3000L1	CD1a, labeled with Fluorescein Isothiocyanate	MCD1a	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3001L1	CD2, labeled with Fluorescein Isothiocyanate	B-E2	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3001P2	CD2	B-E2	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3001P3	CD2	B-E2	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3001L5	CD2, labeled with Phycoerythrin	B-E2	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3001P1	CD2	B-E2	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3011P3	CD20	B-ly1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3011P1	CD20	B-ly1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3011L6	CD20, labeled with Allephycocyanin	B-ly1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Allephycocyanin
MUB3011L5	CD20, labeled with Phycoerythrin	B-ly1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Phycoerythrin
MUB3011P2	CD20	B-ly1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3011L1	CD20, labeled with Fluorescein Isothiocyanate	B-ly1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3011L8	CD20, labeled with Peridinin-Chlorophyll-Protein Complex	B-ly1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Peridinin-Chlorophyll-Protein Complex
MUB3012P3	CD21	B-ly4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3012P1	CD21	B-ly4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3012L1	CD21, labeled with Fluorescein Isothiocyanate	B-ly4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3012L5	CD21, labeled with Phycoerythrin	B-ly4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Phycoerythrin
MUB3012P2	CD21	B-ly4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3013P2	CD22	B-ly8	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3013L1	CD22, labeled with Fluorescein Isothiocyanate	B-ly8	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3013L5	CD22, labeled with Phycoerythrin	B-ly8	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3013P1	CD22	B-ly8	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3013P3	CD22	B-ly8	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3014P3	CD23	B-G6	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3014P1	CD23	B-G6	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3014L5	CD23, labeled with Phycoerythrin	B-G6	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3014P2	CD23	B-G6	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3035P3	CD235a	NaM10-6G4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3035P1	CD235a	NaM10-6G4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3035P2	CD235a	NaM10-6G4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3035L1	CD235a, labeled with Fluorescein Isothiocyanate	NaM10-6G4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB0366S	CD27	LG.8A6	CD markers	The Hamster monoclonal LG.8A6 or CD27 is raised using the immunogen being an Armenian Hamster fibroblast line ARH012 transfected with mouse CD27 cDNA. CD27 is a lypmphocyte restricted member of the Tumor necrosis Receptor Family which binds to CD70. The antibody is specific for a mouse specific leukocyte antigen and cross reacts with rat leukocytes. The CD27 molecule is a 45 kDa transmembrane glycoproteins constutively expressed by lymphocytes of the T cell lineage. CD27 is expressed in nearly all thymocytes, and over 90% of peripheral T cells with both an a-b and a g-d T cell receptor. The epitope specificity for clone CD27 LG.3A10 is different from the epitope specificity for clone LG.8A6.	Human,Mouse		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunoprecipitation	Immunology	None
MUB0366P	CD27	LG.8A6	CD markers	The Hamster monoclonal LG.8A6 or CD27 is raised using the immunogen being an Armenian Hamster fibroblast line ARH012 transfected with mouse CD27 cDNA. CD27 is a lypmphocyte restricted member of the Tumor necrosis Receptor Family which binds to CD70. The antibody is specific for a mouse specific leukocyte antigen and cross reacts with rat leukocytes. The CD27 molecule is a 45 kDa transmembrane glycoproteins constutively expressed by lymphocytes of the T cell lineage. CD27 is expressed in nearly all thymocytes, and over 90% of peripheral T cells with both an a-b and a g-d T cell receptor. The epitope specificity for clone CD27 LG.3A10 is different from the epitope specificity for clone LG.8A6.	Human,Mouse		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunoprecipitation	Immunology	None
MUB0365S	CD27	LG.3A10	CD markers, Tumour marker	The Hamster monoclonal LG.3A10 or CD27 is raised using the immunogen being an Armenian Hamster fibroblast line ARH012 transfected with mouse CD27 cDNA. CD27 is a lypmphocyte restricted member of the Tumor necrosis Receptor Family which binds to CD70. The antibody is specific for a mouse specific leukocyte antigen and cross reacts with rat leukocytes. The CD27 molecule is a 45 kDa transmembrane glycoproteins constutively expressed by lymphocytes of the T cell lineage. CD27 is expressed in nearly all thymocytes, and over 90% of peripheral T cells with both an a-b and a g-d T cell receptor. The epitope specificity for clone CD27 LG. 3A10 is different from the epitope for CD27 clone LG. 8A6.	Human,Mouse		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation	Cell adhesion,Immunology	None
MUB0365P	CD27	LG.3A10	CD markers, Tumour marker	The Hamster monoclonal LG.3A10 or CD27 is raised using the immunogen being an Armenian Hamster fibroblast line ARH012 transfected with mouse CD27 cDNA. CD27 is a lypmphocyte restricted member of the Tumor necrosis Receptor Family which binds to CD70. The antibody is specific for a mouse specific leukocyte antigen and cross reacts with rat leukocytes. The CD27 molecule is a 45 kDa transmembrane glycoproteins constutively expressed by lymphocytes of the T cell lineage. CD27 is expressed in nearly all thymocytes, and over 90% of peripheral T cells with both an a-b and a g-d T cell receptor. The epitope specificity for clone CD27 LG. 3A10 is different from the epitope for CD27 clone LG. 8A6.	Human,Mouse		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation	Cell adhesion,Immunology	None
MUB3015P1	CD33	WM53	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3015P3	CD33	WM53	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3015L5	CD33, labeled with Phycoerythrin	WM53	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Phycoerythrin
MUB3015P2	CD33	WM53	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3016L1	CD34, labeled with Fluorescein Isothiocyanate	581	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3016P3	CD34	581	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3016L5	CD34, labeled with Phycoerythrin	581	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3016P1	CD34	581	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3016P2	CD34	581	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3016L5	CD34, labeled with Phycoerythrin	581	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB0331S	CD34 (Endothelial Cell Marker)	Q-bend 10	CD markers, Membrane		Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3017P2	CD38	T16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3017P3	CD38	T16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3017P4	CD38, labeled with Allephycocyanin	T16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Allephycocyanin
MUB3017L7	CD38, labeled with Cyanine 5.18 and Phycoerythrin	T16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Cyanine 5.18 and Phycoerythrin
MUB3017L5	CD38, labeled with Phycoerythrin	T16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3017L9	CD38, labeled with Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5	T16	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5
MUB3002L1	CD4, labeled with Fluorescein Isothiocyanate	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3002P3	CD4	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3002L9	CD4, labeled with Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Peridinin-Chlorophyll-Protein Complex and Cyanine 5.5
MUB3002L8	CD4, labeled with Peridinin-Chlorophyll-Protein Complex	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Peridinin-Chlorophyll-Protein Complex
MUB3002L7	CD4, labeled with Cyanine 5.18 and Phycoerythrin	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Cyanine 5.18 and Phycoerythrin
MUB3002L5	CD4, labeled with Phycoerythrin	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Phycoerythrin
MUB3002P2	CD4	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3002L6	CD4, labeled with Allephycocyanin	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Allephycocyanin
MUB3002P1	CD4	Edu-2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3018L1	CD43, labeled with Fluorescein Isothiocyanate	MT1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3018P2	CD43	MT1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3018L5	CD43, labeled with Phycoerythrin	MT1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Phycoerythrin
MUB3018P1	CD43	MT1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3018P3	CD43	MT1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3019L1	CD44, labeled with Fluorescein Isothiocyanate	MEM-85	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3019L5	CD44, labeled with Phycoerythrin	MEM-85	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3019P1	CD44	MEM-85	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3019P3	CD44	MEM-85	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3019P2	CD44	MEM-85	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3020P2	CD45	ML2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3020L5	CD45, labeled with Phycoerythrin	ML2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Phycoerythrin
MUB3020L8	CD45, labeled with Peridinin-Chlorophyll-Protein Complex	ML2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Peridinin-Chlorophyll-Protein Complex
MUB3020L6	CD45, labeled with Allephycocyanin	ML2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Allephycocyanin
MUB3020P3	CD45	ML2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3020L7	CD45, labeled with Cyanine 5.18 and Phycoerythrin	ML2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Cyanine 5.18 and Phycoerythrin
MUB3020P1	CD45	ML2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3020L1	CD45, labeled with Fluorescein Isothiocyanate	ML2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3021P2	CD45RA	MB1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3021P3	CD45RA	MB1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3021L1	CD45RA, labeled with Fluorescein Isothiocyanate	MB1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3021L5	CD45RA, labeled with Phycoerythrin	MB1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Phycoerythrin
MUB3021P1	CD45RA	MB1	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3022P1	CD45RB	MT4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3022P2	CD45RB	MT4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3022P3	CD45RB	MT4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3022L5	CD45RB, labeled with Phycoerythrin	MT4	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Phycoerythrin
MUB3023P2	CD45RC	MT2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3023P1	CD45RC	MT2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3023L1	CD45RC, labeled with Fluorescein Isothiocyanate	MT2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3023P3	CD45RC	MT2	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1903S	CD45RO	UCHL-1	CD markers	UCHL-1, is derived by fusion of mouse P3/NS-1/1-Ag4-1 myeloma cells with spleen cells from Balb/c mice immunized with an interleukin-2 (IL-2)-dependent human T-cell line. CD45RO is a 180 kD single chain membrane glycoprotein. It is a splice variant of the tyrosine phosphatase CD45, lacking the A, B, and C determinants. The CD45RO isoform is expressed on activated and memory T cells, some B cell subsets, activated monocytes/macrophages and granulocytes. CD45RO enhances both T cell receptor and B cell receptor signaling mediated activation. CD45 and its isoforms non-covalently associate with lymphocyte phosphatase-associated phosphoprotein (LPAP) on T and B lymphocytes. CD45 has been reported to be associated with several other cell surface antigens including CD1, CD2, CD3, and CD4. CD45 has also been reported to bind galectin-1 and CD22. CD45 isoform expression can change in response to cytokines.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Immunology	None
MUB3003P1	CD5	MCD5	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3003L1	CD5, labeled with Fluorescein Isothiocyanate	MCD5	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3003P3	CD5	MCD5	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3003L5	CD5, labeled with Phycoerythrin	MCD5	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3003P2	CD5	MCD5	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		None
MUB3024L5	CD55, labeled with Phycoerythrin	NaM16-4D3	CD markers		Human		Purified monoclonal antibody	Flow Cytometry		Phycoerythrin
MUB3025P3	CD56	MOC-1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry		None
MUB3025L5	CD56, labeled with Phycoerythrin	MOC-1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry		Phycoerythrin
MUB3025P1	CD56	MOC-1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry		None
MUB3025P2	CD56	MOC-1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry		None
MUB3026L5	CD59, labeled with Phycoerythrin	NaM172-2B5	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Phycoerythrin
MUB3026L1	CD59, labeled with Fluorescein Isothiocyanate	NaM172-2B5	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3028P3	CD64	32.2	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB3027P3	CD64	22	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Western blotting		None
MUB3027P2	CD64	22	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB3028L5	CD64, labeled with Phycoerythrin	32.2	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		Phycoerythrin
MUB3027L5	CD64, labeled with Phycoerythrin	22	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		Phycoerythrin
MUB3028P2	CD64	32.2	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB3028P1	CD64	32.2	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB3027L7	CD64, labeled with Cyanine 5.18 and Phycoerythrin	22	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		Cyanine 5.18 and Phycoerythrin
MUB3027P1	CD64	22	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB3027L1	CD64, labeled with Fluorescein Isothiocyanate	22	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		Fluorescein Isothiocyanate
MUB3028L1	CD64, labeled with Fluorescein Isothiocyanate	32.2	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Western blotting		Fluorescein Isothiocyanate
MUB3004L5	CD7, labeled with Phycoerythrin	B-B7	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Phycoerythrin
MUB3004P1	CD7	B-B7	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3004P2	CD7	B-B7	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3004P3	CD7	B-B7	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		None
MUB3004L1	CD7, labeled with Fluorescein Isothiocyanate	B-B7	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen		Fluorescein Isothiocyanate
MUB3029P1	CD71	DF1513	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3029L1	CD71, labeled with Fluorescein Isothiocyanate	DF1513	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3029P3	CD71	DF1513	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3029P2	CD71	DF1513	CD markers		Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3005P2	CD8	MCD8	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3005L8	CD8, labeled with Peridinin-Chlorophyll-Protein Complex	MCD8	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Peridinin-Chlorophyll-Protein Complex
MUB3005P1	CD8	MCD8	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3005L5	CD8, labeled with Phycoerythrin	MCD8	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Phycoerythrin
MUB3005P3	CD8	MCD8	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB3005L1	CD8, labeled with Fluorescein Isothiocyanate	MCD8	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Fluorescein Isothiocyanate
MUB3005L7	CD8, labeled with Cyanine 5.18 and Phycoerythrin	MCD8	CD markers, Membrane		Human		Purified monoclonal antibody			Cyanine 5.18 and Phycoerythrin
MUB3005L6	CD8, labeled with Allephycocyanin	MCD8	CD markers, Membrane		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		Allephycocyanin
MUB0334S	Chromogranin A	LK2H10	Other		Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB0338S	Collagen IV	Polyclonal	Other		Bovine,Human,Rat,Swine		Unpurified polyclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB0337P	Collagen Type IV	1043	Other	1043 is a mouse monoclonal IgG2b antibody derived by fusion of Sp 2/0 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with purified human type IV collagen. The immunogen has been isolated from human placenta. 1043 recognizes the extracellular – basemenmembranes.	Bovine,Human,Swine		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer	None
MUB0337S	Collagen Type IV	1043	Other	1043 is a mouse monoclonal IgG2b antibody derived by fusion of Sp 2/0 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with purified human type IV collagen. The immunogen has been isolated from human placenta. 1043 recognizes the extracellular – basemenmembranes.	Bovine,Human,Swine		Supernatant monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer	None
MUB0319S	Cytokeratin 10 / Keratin K10	RKSE60	Cytoskeletal	RKSE60 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with cytokeratins from the human epidermis. RKSE60 reacts exclusively with cytokeratin 10 which is present in keratinizing stratified epithelia and in differentiated areas of highly differentiated squamous cell carcinomas.	Canine,Human,Mouse,Rat,Swine,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0320P	Cytokeratin 10 / Keratin K10	DE-K10	Cytoskeletal	DE-K10 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a (BALB/c x B6)F1 mouse immunized with a cytoskeletal preparation extracted from human epidermis. DE-K10 reacts exclusively with cytokeratin 10 which is present in keratinizing stratified epithelia and in differentiated areas of highly differentiated squamous cell carcinomas.	Canine,Feline,Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0320S	Cytokeratin 10 / Keratin K10	DE-K10	Cytoskeletal	DE-K10 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a (BALB/c x B6)F1 mouse immunized with a cytoskeletal preparation extracted from human epidermis. DE-K10 reacts exclusively with cytokeratin 10 which is present in keratinizing stratified epithelia and in differentiated areas of highly differentiated squamous cell carcinomas.	Canine,Feline,Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0319P	Cytokeratin 10 / Keratin K10	RKSE60	Cytoskeletal	RKSE60 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with cytokeratins from the human epidermis. RKSE60 reacts exclusively with cytokeratin 10 which is present in keratinizing stratified epithelia and in differentiated areas of highly differentiated squamous cell carcinomas.	Canine,Human,Mouse,Rat,Swine,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0321S	Cytokeratin 10+13 / Keratin K10+K13	DE-K13	Cytoskeletal	DE-K13 is a mouse monoclonal IgG2a, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a (BALB/c x B6)F1 mouse immunized with a cytoskeletal preparation extracted from human ectocervical epithelium. DE-K13 reacts with cytokeratin 10 and 13 in fixed cells and on frozen tissues, but exclusively with cytokeratin 13 in formalin-fixed, paraffin- embedded tissues. Cytokeratin 10 is present in keratinizing stratified epithelia and in differentiated areas of highly differentiated squamous cell carcinomas, while cytokeratin 13 is present in non- cornified squamous epithelia, except cornea, and transitional epithelial regions, with the exception of basal cell layers of some stratified epithelia, as well as carcinomas derived from these tissues.	Feline,Human,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0321P	Cytokeratin 10+13 / Keratin K10+K13	DE-K13	Cytoskeletal	DE-K13 is a mouse monoclonal IgG2a, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a (BALB/c x B6)F1 mouse immunized with a cytoskeletal preparation extracted from human ectocervical epithelium. DE-K13 reacts with cytokeratin 10 and 13 in fixed cells and on frozen tissues, but exclusively with cytokeratin 13 in formalin-fixed, paraffin- embedded tissues. Cytokeratin 10 is present in keratinizing stratified epithelia and in differentiated areas of highly differentiated squamous cell carcinomas, while cytokeratin 13 is present in non- cornified squamous epithelia, except cornea, and transitional epithelial regions, with the exception of basal cell layers of some stratified epithelia, as well as carcinomas derived from these tissues.	Feline,Human,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0344S	Cytokeratin 13	2D7	Cytoskeletal		Human	Human, most mammals, including mouse, rat and rabbit.	Supernatant monoclonal antibody	Immunohistochemistry frozen ,Western blotting		None
MUB0340S	Cytokeratin 13	Ks13.1	Cytoskeletal		Bovine,Human,Rat		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB0322P	Cytokeratin 13 / Keratin K13	1C7	Cytoskeletal	1C7 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytokeratin preparation extracted from human esophagus. 1C7 reacts exclusively with cytokeratin 13 which is present in non-cornified squamous epithelia, except cornea, and transitional epithelial regions, with the exception of basal cell layers of some stratified epithelia.	Human		Purified monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0322S	Cytokeratin 13 / Keratin K13	1C7	Cytoskeletal	1C7 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytokeratin preparation extracted from human esophagus. 1C7 reacts exclusively with cytokeratin 13 which is present in non-cornified squamous epithelia, except cornea, and transitional epithelial regions, with the exception of basal cell layers of some stratified epithelia.	Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0324S	Cytokeratin 14	SPK-14	Cytoskeletal		Feline,Human,Swine		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting		None
MUB0323S	Cytokeratin 14 / Keratin K14	RCK107	Cytoskeletal	RCK107 is a mouse monoclonal IgG3 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal preparation of TR146 epithelial cells. RCK107 reacts exclusively with cytokeratin 14 which is present in basal cell compartments of stratified and combined epithelia.	Canine,Human,Rat,Swine		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0323P	Cytokeratin 14 / Keratin K14	RCK107	Cytoskeletal	RCK107 is a mouse monoclonal IgG3 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal preparation of TR146 epithelial cells. RCK107 reacts exclusively with cytokeratin 14 which is present in basal cell compartments of stratified and combined epithelia.	Canine,Human,Rat,Swine		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0351S	Cytokeratin 16 / Keratin K16	LL025	Cytoskeletal	LL025 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 murine myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to an amino acid sequence of the carboxyl terminus of human keratin 16.	Human		Supernatant monoclonal antibody		Cell differentiation,Cytoskeleton	None
MUB0351P	Cytokeratin 16 / Keratin K16	LL025	Cytoskeletal	LL025 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 murine myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to an amino acid sequence of the carboxyl terminus of human keratin 16.	Human		Purified monoclonal antibody		Cell differentiation,Cytoskeleton	None
MUB0341S	Cytokeratin 17	Ks17.E3	Cytoskeletal		Human,Rat		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB0325P	Cytokeratin 17 / Keratin K17	E3	Cytoskeletal	E3 is a mouse monoclonal IgG2b antibody derived by fusion of X63 Ag 8.653 mouse myeloma cells with spleen cells from a Balb/c mouse immunized with a cytoskeletal preparation from rat colon. E3 reacts with cytokeratin 17 in basal layers of pseudo-stratified and transitional epithelia.	Human,Rat		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0328P	Cytokeratin 18 / Keratin K18	DE-K18	Cytoskeletal	DE-K18 is a mouse monoclonal IgG1, κ antibodyderived by fusion of SP2/0 mouse myeloma cellswith spleen cells from a (BALB/c x B6)F1 mouse immunized with a cytoskeletal preparation extracted from the human vulvar squamous carcinoma cell line A431. DE-K18 reacts exclusively with cytokeratin 18 which is present in glandular epithelial cells of the digestive, respiratory, and urogenital tracts, endocrine andexocrine cells and mesothelial cells, as well as adenocarcinomas originating therefrom.	Canine,Feline,Human,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0327P	Cytokeratin 18 / Keratin K18	RCK106	Cytoskeletal	RCK106 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with cytokeratins from the human bladder carcinoma cell line T24. RCK106 reacts exclusively with cytokeratin 18 in glandular epithelial cells of the digestive, respiratory, and urogenital tracts, endocrine and exocrine cells and mesothelial cells, as well as adenocarcinomas originating from them.	Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation,Cytoskeleton	None
MUB0328S	Cytokeratin 18 / Keratin K18	DE-K18	Cytoskeletal	DE-K18 is a mouse monoclonal IgG1, κ antibodyderived by fusion of SP2/0 mouse myeloma cellswith spleen cells from a (BALB/c x B6)F1 mouse immunized with a cytoskeletal preparation extracted from the human vulvar squamous carcinoma cell line A431. DE-K18 reacts exclusively with cytokeratin 18 which is present in glandular epithelial cells of the digestive, respiratory, and urogenital tracts, endocrine andexocrine cells and mesothelial cells, as well as adenocarcinomas originating therefrom.	Canine,Feline,Human,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0326P	Cytokeratin 18 / Keratin K18	RGE53	Cytoskeletal	RGE53 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal preparation of cells. RGE53 reacts exclusively with cytokeratin 18 which is present in glandular epithelial cells of the digestive, respiratory, and urogenital tracts, endocrine and exocrine cells and mesothelial cells, as well as adenocarcinomas originating from them.	Canine,Chicken,Hamster,Human,Mouse,Rabbit,Rat,Swine,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0326S	Cytokeratin 18 / Keratin K18	RGE53	Cytoskeletal	RGE53 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal preparation of cells. RGE53 reacts exclusively with cytokeratin 18 which is present in glandular epithelial cells of the digestive, respiratory, and urogenital tracts, endocrine and exocrine cells and mesothelial cells, as well as adenocarcinomas originating from them.	Canine,Chicken,Hamster,Human,Mouse,Rabbit,Rat,Swine,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0327S	Cytokeratin 18 / Keratin K18	RCK106	Cytoskeletal	RCK106 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with cytokeratins from the human bladder carcinoma cell line T24. RCK106 reacts exclusively with cytokeratin 18 in glandular epithelial cells of the digestive, respiratory, and urogenital tracts, endocrine and exocrine cells and mesothelial cells, as well as adenocarcinomas originating from them.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation,Cytoskeleton	None
MUB0329S	Cytokeratin 19 / Keratin K19	RCK108	Cytoskeletal	RCK108 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytoskeletal preparation of human bladder carcinoma cell line T24. RCK108 reacts exclusively with cytokeratin 19 which is present in glandular-type epithelia and most carcinomas. Does not react with hepatocytes and hepatocellular carcinoma.	Human,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation,Cytoskeleton	None
MUB0329P	Cytokeratin 19 / Keratin K19	RCK108	Cytoskeletal	RCK108 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytoskeletal preparation of human bladder carcinoma cell line T24. RCK108 reacts exclusively with cytokeratin 19 which is present in glandular-type epithelia and most carcinomas. Does not react with hepatocytes and hepatocellular carcinoma.	Human,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation,Cytoskeleton	None
MUB0343S	Cytokeratin 20	MKs20-8	Cytoskeletal		Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting		None
MUB0342S	Cytokeratin 2e	Ks2.342.7.1	Cytoskeletal		Bovine,Human,Mouse,Rat		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting		None
MUB0313P	Cytokeratin 4 / Keratin K4	6B10	Cytoskeletal	6B10 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytokeratin preparation extracted from human esophagus. 6B10 reacts exclusively with cytokeratin 4 which is present in non-cornifying squamous epithelium, including cornea and transitional epithelium. Cells in certain ciliated pseudo-stratified epithelia and ductal epithelia of various exocrine glands are also positive for 6B10.	Canine,Feline,Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunoprecipitation,Western blotting	Cancer,Cytoskeleton	None
MUB0313S	Cytokeratin 4 / Keratin K4	6B10	Cytoskeletal	6B10 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytokeratin preparation extracted from human esophagus. 6B10 reacts exclusively with cytokeratin 4 which is present in non-cornifying squamous epithelium, including cornea and transitional epithelium. Cells in certain ciliated pseudo-stratified epithelia and ductal epithelia of various exocrine glands are also positive for 6B10.	Canine,Feline,Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunoprecipitation,Western blotting	Cancer,Cytoskeleton	None
MUB0314P	Cytokeratin 5+8 / Keratin K5+k8	RCK102	Cytoskeletal	RCK102 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with cytokeratins from a human lung cancer cell line (MR21). RCK102 is reacting with cytokeratin 5 and cytokeratin 8. This monoclonal antibody recognizes virtually all epithelial tissues and carcinomas.	Canine,Feline,Hamster,Human,Mouse,Rabbit,Rat		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Stem cell research	None
MUB0314S	Cytokeratin 5+8 / Keratin K5+k8	RCK102	Cytoskeletal	RCK102 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with cytokeratins from a human lung cancer cell line (MR21). RCK102 is reacting with cytokeratin 5 and cytokeratin 8. This monoclonal antibody recognizes virtually all epithelial tissues and carcinomas.	Canine,Feline,Hamster,Human,Mouse,Rabbit,Rat		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Stem cell research	None
MUB0345S	Cytokeratin 6	Ks6.KA12	Cytoskeletal		Human,Mouse		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB0350P	Cytokeratin 6 / Keratin K6	LL020	Cytoskeletal	LL020 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 murine myeloma cells with spleen cells from a mouse immunized with a carboxyterminal peptide of cytokeratin 6.	Human,Zebrafish		Purified monoclonal antibody		Cell differentiation,Cytoskeleton	None
MUB0350S	Cytokeratin 6 / Keratin K6	LL020	Cytoskeletal	LL020 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 murine myeloma cells with spleen cells from a mouse immunized with a carboxyterminal peptide of cytokeratin 6.	Human,Zebrafish		Supernatant monoclonal antibody		Cell differentiation,Cytoskeleton	None
MUB0316P	Cytokeratin 7 / Keratin K7	OVTL12/30	Cytoskeletal	OVTL12/30 is a mouse monoclonal IgG1/κ antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal preparation of OTN-11 ovarian carcinoma cell line. OVTL12/30 reacts exlcusively with cytokeratin 7 which is present in specific glandular-type epithelia and most carcinomas derived thereof.	Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0315S	Cytokeratin 7 / Keratin K7	RCK105	Cytoskeletal	RCK105 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with cytokeratins from the human bladder carcinoma cell line T24. RCK105 reacts exclusively with cytokeratin 7 which is present in a subgroup of glandular epithelia and their tumors, as well as transitional epithelium and transitional carcinoma.	Canine,Feline,Goat,Hamster,Human,Mouse,Rat,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton	None
MUB0316S	Cytokeratin 7 / Keratin K7	OVTL12/30	Cytoskeletal	OVTL12/30 is a mouse monoclonal IgG1/κ antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal preparation of OTN-11 ovarian carcinoma cell line. OVTL12/30 reacts exlcusively with cytokeratin 7 which is present in specific glandular-type epithelia and most carcinomas derived thereof.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0315P	Cytokeratin 7 / Keratin K7	RCK105	Cytoskeletal	RCK105 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with cytokeratins from the human bladder carcinoma cell line T24. RCK105 reacts exclusively with cytokeratin 7 which is present in a subgroup of glandular epithelia and their tumors, as well as transitional epithelium and transitional carcinoma.	Canine,Feline,Goat,Hamster,Human,Mouse,Rat,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton	None
MUB0346S	Cytokeratin 8	Ks8.7	Cytoskeletal		Hamster,Human,Mouse,Rat,Swine		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB0318S	Cytokeratin 8 / Keratin K8	M20	Cytoskeletal	M20 is a mouse monoclonal IgG1 antibody derived by fusion of murine myeloma cells with spleen cells from a mouse immunized with keratin isolated from the human breast carcinoma cell line MCF-7. M20 reacts with glandular epithelial cells (endocrine and exocrine) as well as mesothelial cells of the digestive, respiratory and urogenital tract and most adenocarcinomas derived from these cells.	Human,Rabbit,Rat		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0352P	Cytokeratin 8 / Keratin K8	35βH11	Cytoskeletal	35ßH11 is a mouse monoclonal IgM antibody derived by fusion of NS-1 mouse myeloma cells with spleen cells from a Balb/c mouse immunized with a cytoskeletal preparation of the human hepotocellular carcinoma cell line Hep3B.	Human		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation,Cytoskeleton	None
MUB0318P	Cytokeratin 8 / Keratin K8	M20	Cytoskeletal	M20 is a mouse monoclonal IgG1 antibody derived by fusion of murine myeloma cells with spleen cells from a mouse immunized with keratin isolated from the human breast carcinoma cell line MCF-7. M20 reacts with glandular epithelial cells (endocrine and exocrine) as well as mesothelial cells of the digestive, respiratory and urogenital tract and most adenocarcinomas derived from these cells.	Human,Rabbit,Rat		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0352S	Cytokeratin 8 / Keratin K8	35βH11	Cytoskeletal	35ßH11 is a mouse monoclonal IgM antibody derived by fusion of NS-1 mouse myeloma cells with spleen cells from a Balb/c mouse immunized with a cytoskeletal preparation of the human hepotocellular carcinoma cell line Hep3B.	Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell differentiation,Cytoskeleton	None
MUB0317S	Cytokeratin 8 / Keratin K8	H1	Cytoskeletal	H1 is a mouse monoclonal IgG1 antibody derived by fusion of murine myeloma cells with spleen cells from a mouse immunized with a cytoskeleton preparation containing cytokeratin 8. H1 reacts with glandular epithelial cells (endocrineand exocrine) as well as mesothelial cells of the digestive, respiratory and urogenital tract and most adenocarcinomas derived from these cells.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0317P	Cytokeratin 8 / Keratin K8	H1	Cytoskeletal	H1 is a mouse monoclonal IgG1 antibody derived by fusion of murine myeloma cells with spleen cells from a mouse immunized with a cytoskeleton preparation containing cytokeratin 8. H1 reacts with glandular epithelial cells (endocrineand exocrine) as well as mesothelial cells of the digestive, respiratory and urogenital tract and most adenocarcinomas derived from these cells.	Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton	None
MUB0348S	Cytokeratin 8+18	NCL-5D3	Cytoskeletal		Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB0401S	Desmin	D9	Cytoskeletal	D9 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with desmin isolated from human leiomyoma. D9 reacts exclusively with desmin, which is expressed in smooth and striated muscle cells and their tumors e.g. rhabdomyosarcoma and leiomyosarcoma.	Chicken,Human,Mouse,Rabbit,Rat,Swine		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cardiovascular,Cell adhesion,Cytoskeleton	None
MUB0400P	Desmin	RD301	Cytoskeletal	RD301 is a mouse monoclonal IgG2b antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal desmin extract of chicken gizzard. RD301 reacts exclusively with desmin, which is expressed in smooth and striated muscle cells and their tumors e.g. rhabdomyosarcoma and leiomyosarcoma.	Canine,Chicken,Hamster,Human,Mouse,Rabbit,Rat,Swine		Purified monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cancer,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0401P	Desmin	D9	Cytoskeletal	D9 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with desmin isolated from human leiomyoma. D9 reacts exclusively with desmin, which is expressed in smooth and striated muscle cells and their tumors e.g. rhabdomyosarcoma and leiomyosarcoma.	Chicken,Human,Mouse,Rabbit,Rat,Swine		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cardiovascular,Cell adhesion,Cytoskeleton	None
MUB0400S	Desmin	RD301	Cytoskeletal	RD301 is a mouse monoclonal IgG2b antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal desmin extract of chicken gizzard. RD301 reacts exclusively with desmin, which is expressed in smooth and striated muscle cells and their tumors e.g. rhabdomyosarcoma and leiomyosarcoma.	Canine,Chicken,Hamster,Human,Mouse,Rabbit,Rat,Swine		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cancer,Cell differentiation,Cytoskeleton,Stem cell research	None
MUB0402S	Desmin K5	Polyclonal	Cytoskeletal		Bovine,Chicken,Goat,Hamster,Human,Mouse,Rat		Unpurified polyclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB2015P	DGKa	M6	Other		Human		Purified monoclonal antibody	Immunoprecipitation,Western blotting		None
MUB2016P	DGKa	M8	Other		Human		Purified monoclonal antibody	Immunoprecipitation,Western blotting		None
MUB2009P	DGKa	M5a	Other		Human		Purified monoclonal antibody	Immunoprecipitation,Western blotting		None
MUB0304P	E-Cadherin / Cadherin-1	SEC21	Cell adhesion	SEC21 is a mouse monoclonal IgG1 antibody obtained by fusion of NS0 mouse myeloma cells with spleen cells from a mouse immunized with the synthetic peptide corresponding to amino acids 30-43 of mature human E-cadherin coupled to keyhole limpet hemocyanin. SEC21 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part. The epitope is present within amino acid residues 30-43 of mature human E-cadherin.	Human		Purified monoclonal antibody	Western blotting	Cell adhesion	None
MUB0301S	E-Cadherin / Cadherin-1	5H9	Cell adhesion	5H9 is a mouse monoclonal IgG1 antibody obtained by fusion of P3-X63-Ag 8.653 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with affinity purified 80 kD extracellular fragments of E-cadherin derived from tryptic digestion of A-431 human vulva carcinoma cells.	Human		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0304S	E-Cadherin / Cadherin-1	SEC21	Cell adhesion	SEC21 is a mouse monoclonal IgG1 antibody obtained by fusion of NS0 mouse myeloma cells with spleen cells from a mouse immunized with the synthetic peptide corresponding to amino acids 30-43 of mature human E-cadherin coupled to keyhole limpet hemocyanin. SEC21 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part. The epitope is present within amino acid residues 30-43 of mature human E-cadherin.	Human		Supernatant monoclonal antibody	Western blotting	Cell adhesion	None
MUB0300P	E-Cadherin / Cadherin-1	MB2	Cell adhesion	MB2 is a mouse monoclonal IgG2b antibody derived by fusion of NS0 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with MCF-7/AZ cells expressing E-cadherin at their cell surface. MB2 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part. MB2 is a functional antibody in that it inhibits cell-cell adhesion.	Human,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0301P	E-Cadherin / Cadherin-1	5H9	Cell adhesion	5H9 is a mouse monoclonal IgG1 antibody obtained by fusion of P3-X63-Ag 8.653 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with affinity purified 80 kD extracellular fragments of E-cadherin derived from tryptic digestion of A-431 human vulva carcinoma cells.	Human		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0303P	E-Cadherin / Cadherin-1	SEC11	Cell adhesion	SEC11 is a mouse monoclonal IgG1 antibody obtained by fusion of NS0 mouse myeloma cells with spleen cells from a mouse immunized with the synthetic peptide corresponding to amino acids 9-21 of mature human E-cadherin coupled to keyhole limpet hemocyanin. SEC11 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part. The epitope is present within amino acid residues 9-21 of mature human E-cadherin	Canine,Human		Purified monoclonal antibody	Western blotting	Cell adhesion	None
MUB0302S	E-Cadherin / Cadherin-1	6F9	Cell adhesion	6F9 is a mouse monoclonal IgG1 antibody obtained by fusion of P3-X63-Ag 8,653 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with affinity purified 80 kD extracellular fragments of E-cadherin derived from tryptic digestion of A-431 human vulva carcinoma cells. 6F9 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part.Extracellular fragments of E-cadherin derived from tryptic digestion of A-431 human vulva carcinoma cells. 6F9 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part.	Human		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0302P	E-Cadherin / Cadherin-1	6F9	Cell adhesion	6F9 is a mouse monoclonal IgG1 antibody obtained by fusion of P3-X63-Ag 8,653 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with affinity purified 80 kD extracellular fragments of E-cadherin derived from tryptic digestion of A-431 human vulva carcinoma cells. 6F9 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part.Extracellular fragments of E-cadherin derived from tryptic digestion of A-431 human vulva carcinoma cells. 6F9 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part.	Human		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0300S	E-Cadherin / Cadherin-1	MB2	Cell adhesion	MB2 is a mouse monoclonal IgG2b antibody derived by fusion of NS0 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with MCF-7/AZ cells expressing E-cadherin at their cell surface. MB2 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part. MB2 is a functional antibody in that it inhibits cell-cell adhesion.	Human,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0303S	E-Cadherin / Cadherin-1	SEC11	Cell adhesion	SEC11 is a mouse monoclonal IgG1 antibody obtained by fusion of NS0 mouse myeloma cells with spleen cells from a mouse immunized with the synthetic peptide corresponding to amino acids 9-21 of mature human E-cadherin coupled to keyhole limpet hemocyanin. SEC11 recognizes both the 120 kD E-cadherin and its 80 kD trypsin-resistant extracellular part. The epitope is present within amino acid residues 9-21 of mature human E-cadherin	Canine,Human		Supernatant monoclonal antibody	Western blotting	Cell adhesion	None
MUB0501S	Entactin / Nidogen	ELM1	Cell adhesion, Extracellular matrix	ELM1 is a rat monoclonal IgG2a antibody derived by fusion of X63 Ag 8.653 mouse myeloma cells with spleen cells from a Fisher rat immunized with a partially purified preparation of laminin from the EHS mouse tumor.	Mouse		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell adhesion	None
MUB0501P	Entactin / Nidogen	ELM1	Cell adhesion, Extracellular matrix	ELM1 is a rat monoclonal IgG2a antibody derived by fusion of X63 Ag 8.653 mouse myeloma cells with spleen cells from a Fisher rat immunized with a partially purified preparation of laminin from the EHS mouse tumor.	Mouse		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell adhesion	None
MUB0502P	Ep-CAM	VU1D9	Cell adhesion	VU1D9 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with native Ep-CAM from lung tissue. VU1D9 reacts with the first EGF repeat in the extracellular domain of Ep-CAM. The epitope is sensitive for reducing agents.	Human		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell adhesion	None
MUB0509S	Ep-CAM	G8.8	Cell adhesion	G8.8 is a rat monoclonal IgG2a antibody derived by fusion of spleen lymphocytes from rats repeatedly immunized with a glycoconjugates isloted from TE- 71 BALB/c mouse derived medullary thymic epithelial cells and rat X63-Ag8.653 myeloma cells.	Mouse		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cancer,Cell adhesion	None
MUB0509P	Ep-CAM	G8.8	Cell adhesion	G8.8 is a rat monoclonal IgG2a antibody derived by fusion of spleen lymphocytes from rats repeatedly immunized with a glycoconjugates isloted from TE- 71 BALB/c mouse derived medullary thymic epithelial cells and rat X63-Ag8.653 myeloma cells.	Mouse		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cancer,Cell adhesion	None
MUB0503P	Episialin	GP1.4	Membrane	GP1.4 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with human milk fat globule. GP1.4 reacts with all glycoforms of Episialin.	Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell adhesion	None
MUB0504P	E-selectin	UZ4	Cell adhesion	UZ4 is a rat monoclonal IgM antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Lewis rat immunized with LPS-activated mlEND1 cells expressing E-selectin at their cell surface. UZ4 recognizes the minimal amino acid consensus sequence CXKKKL present in the lectin domain of both murine and human E-selectin. UZ4 is a functional antibody in that it inhibits leukocyte adhesion to both murine and human activated endothelial cells.	Human,Mouse		Purified monoclonal antibody	Flow Cytometry,Immunofluorescence,Immunoprecipitation,Western blotting	Cell adhesion,Immunology	None
MUB0506S	E-selectin	UZ6	Cell adhesion	UZ6 is a rat monoclonal IgG2b antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Lewis rat immunized with LPS-activated mlEND1 cells expressing E-selectin at their cell surface. UZ6 recognizes a conformational epitope in the CR2 region in murine E-selectin. UZ6 partially inhibits leukocyte adhesion to murine activated endothelial cells.	Mouse		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion,Immunology	None
MUB0507S	E-selectin	UZ7	Cell adhesion	UZ7 is a rat monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Lewis rat immunized with LPS-activated mlEND1 cells expressing E-selectin at their cell surface. UZ7 recognizes a conformational epitope in the CR1 region in murine E-selectin. UZ7 partially inhibits leukocyte adhesion to murine activated endothelial cells.	Mouse		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion,Immunology	None
MUB0507P	E-selectin	UZ7	Cell adhesion	UZ7 is a rat monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Lewis rat immunized with LPS-activated mlEND1 cells expressing E-selectin at their cell surface. UZ7 recognizes a conformational epitope in the CR1 region in murine E-selectin. UZ7 partially inhibits leukocyte adhesion to murine activated endothelial cells.	Mouse		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion,Immunology	None
MUB0506P	E-selectin	UZ6	Cell adhesion	UZ6 is a rat monoclonal IgG2b antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Lewis rat immunized with LPS-activated mlEND1 cells expressing E-selectin at their cell surface. UZ6 recognizes a conformational epitope in the CR2 region in murine E-selectin. UZ6 partially inhibits leukocyte adhesion to murine activated endothelial cells.	Mouse		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion,Immunology	None
MUB0504S	E-selectin	UZ4	Cell adhesion	UZ4 is a rat monoclonal IgM antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Lewis rat immunized with LPS-activated mlEND1 cells expressing E-selectin at their cell surface. UZ4 recognizes the minimal amino acid consensus sequence CXKKKL present in the lectin domain of both murine and human E-selectin. UZ4 is a functional antibody in that it inhibits leukocyte adhesion to both murine and human activated endothelial cells.	Human,Mouse		Supernatant monoclonal antibody	Flow Cytometry,Immunofluorescence,Immunoprecipitation,Western blotting	Cell adhesion,Immunology	None
MUB0505S	E-selectin	UZ5	Cell adhesion	UZ5 is a rat monoclonal IgG2b antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Lewis rat immunized with LPS-activated mlEND1 cells expressing E-selectin at their cell surface. UZ5 recognizes a conformational epitope in the CR1 region in murine E-selectin. UZ5 partially inhibits leukocyte adhesion to murine activated endothelial cells.	Mouse		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion,Immunology	None
MUB0505P	E-selectin	UZ5	Cell adhesion	UZ5 is a rat monoclonal IgG2b antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Lewis rat immunized with LPS-activated mlEND1 cells expressing E-selectin at their cell surface. UZ5 recognizes a conformational epitope in the CR1 region in murine E-selectin. UZ5 partially inhibits leukocyte adhesion to murine activated endothelial cells.	Mouse		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion,Immunology	None
MUB0602P	Fibronectin	EP-5	Extracellular matrix	EP-5 is a mouse monoclonal IgG1 antibody. EP-5 reacts with fibronectin in connective tissues and vessels. Animal biodistribution experiments have shown that after intravenous administration, EP 5 antibody localizes to tumor vessels where it binds to the underlying basement membrane. At the same time the antigen recognized by EP-5 antibody is not accessible in normal tissue to circulatingantibody indicating that this antibody can be used to targettumor vessels specifically in vivo.	Human,Mouse		Purified monoclonal antibody	Immunohistochemistry frozen	Cell adhesion	None
MUB0610P	Forssman antigen	117C9	Tumour marker	117C9 is a rat monoclonal antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells of Sprague-Dawley rats immunized with mouse mammary tumor cells. The antibody 33B12 and 117C9 detect overlapping epitopes on the Forssman glycolipid hapten (GalNAc alpha 1-3GalNAc beta 1-3Gal alpha 1-4Gal beta 1-4Glc beta 1-1Cer). The monoclonal antibody 117C9 recognizes the internal sugar sequence GalNAc beta1-3Gal. 117C9 does not react exclusively with the Forssman antigen. In a lipid extract fractionated by Folch partition of mouse mammary tumors, the 117C9 antibody also detects other glycolipids. The majority of human individuals have undetectable levels of the Forssman antigen, whereas gastric, colonic and lung tumors have increased levels of the Forssman antigen.	Mouse		Purified monoclonal antibody	Immunohistochemistry frozen	Cancer,Immunology	None
MUB0610S	Forssman antigen	117C9	Tumour marker	117C9 is a rat monoclonal antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells of Sprague-Dawley rats immunized with mouse mammary tumor cells. The antibody 33B12 and 117C9 detect overlapping epitopes on the Forssman glycolipid hapten (GalNAc alpha 1-3GalNAc beta 1-3Gal alpha 1-4Gal beta 1-4Glc beta 1-1Cer). The monoclonal antibody 117C9 recognizes the internal sugar sequence GalNAc beta1-3Gal. 117C9 does not react exclusively with the Forssman antigen. In a lipid extract fractionated by Folch partition of mouse mammary tumors, the 117C9 antibody also detects other glycolipids. The majority of human individuals have undetectable levels of the Forssman antigen, whereas gastric, colonic and lung tumors have increased levels of the Forssman antigen.	Mouse		Supernatant monoclonal antibody	Immunohistochemistry frozen	Cancer,Immunology	None
MUB0609P	Forssman antigen	33B12	Tumour marker	The antibody 33B12 is a rat anti-Forrsman glycosphingolipid (FGL) antibody derived by fusing mouse myeloma cells with spleen cells from a rat immunized with mouse mammary tumors. The antibody 33B12 and 117C9 detect overlapping epitopes on the Forssman glycolipid hapten (GalNAc alpha 1-3GalNAc beta 1-3Gal alpha 1-4Gal beta 1-4Glc beta 1-1Cer). The antibody 33B12 recognizes cell surface antigens on mesemchymal cells in a variety of tissues. The antibody reacts with the terminal sugar sequence GalNac alpha 1-3GalNAc and is specific for the Forssman glycolipid hapten (GalNAc alpha 1-3GalNAc beta 1-3Gal alpha 1-4Gal beta 1-4Glc beta 1-1Cer).	Mouse		Purified monoclonal antibody	Immunohistochemistry frozen	Cancer,Immunology	None
MUB0609S	Forssman antigen	33B12	Tumour marker	The antibody 33B12 is a rat anti-Forrsman glycosphingolipid (FGL) antibody derived by fusing mouse myeloma cells with spleen cells from a rat immunized with mouse mammary tumors. The antibody 33B12 and 117C9 detect overlapping epitopes on the Forssman glycolipid hapten (GalNAc alpha 1-3GalNAc beta 1-3Gal alpha 1-4Gal beta 1-4Glc beta 1-1Cer). The antibody 33B12 recognizes cell surface antigens on mesemchymal cells in a variety of tissues. The antibody reacts with the terminal sugar sequence GalNac alpha 1-3GalNAc and is specific for the Forssman glycolipid hapten (GalNAc alpha 1-3GalNAc beta 1-3Gal alpha 1-4Gal beta 1-4Glc beta 1-1Cer).	Mouse		Supernatant monoclonal antibody	Immunohistochemistry frozen	Cancer,Immunology	None
MUB0608S	FSH	1038	Hormones		Human		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB0703S	GFAP (+1)	Polyclonal	Other		Human		Unpurified polyclonal antibody	Immunohistochemistry frozen ,Western blotting		None
MUB0702S	GFAP (delta)	Polyclonal	Other		Human		Unpurified polyclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB0700S	GFAP (K39)	Polyclonal	Hormones		Human,Mouse,Rat,Zebrafish		Unpurified polyclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB0701P	Glial fibrillary acidic protein / GFAP	6F2	Cytoskeletal	6F2 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with glial fibrillary acidic protein from human brain. 6F2 reacts exclusively with glial fibrillary acidic protein which is present in astrocytes in the central nervous system and Schwann cells.	Human		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Neurobiology,Stem cell research	None
MUB0701S	Glial fibrillary acidic protein / GFAP	6F2	Cytoskeletal	6F2 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with glial fibrillary acidic protein from human brain. 6F2 reacts exclusively with glial fibrillary acidic protein which is present in astrocytes in the central nervous system and Schwann cells.	Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Neurobiology,Stem cell research	None
MUB0706S	Glucagon	Polyclonal	Hormones		Human,Rat		Unpurified polyclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB0801S	Heparan Sulphate Proteoglycan	A7L6	Extracellular matrix	A7L6 is a rat monoclonal IgG2a antibody derived by fusion of X63 Ag8.653 mouse myeloma cells with spleen cells from a Fisher rat immunized with high molecular mass material derived from the Engelbreth-Holm-Swarm (EHS) tumor matrix containing laminin, entactin and HSPG. A7L6 recognizes domain IV of the core protein of the large heparan sulphate proteoglycan or perlecan. The reactivity is independent of the galactosaminoglycan moieties. Therefore, the epitope is not sensitive to heparitinase treatment.	Bovine,Human,Mouse,Rat		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting		None
MUB0801P	Heparan Sulphate Proteoglycan	A7L6	Extracellular matrix	A7L6 is a rat monoclonal IgG2a antibody derived by fusion of X63 Ag8.653 mouse myeloma cells with spleen cells from a Fisher rat immunized with high molecular mass material derived from the Engelbreth-Holm-Swarm (EHS) tumor matrix containing laminin, entactin and HSPG. A7L6 recognizes domain IV of the core protein of the large heparan sulphate proteoglycan or perlecan. The reactivity is independent of the galactosaminoglycan moieties. Therefore, the epitope is not sensitive to heparitinase treatment.	Bovine,Human,Mouse,Rat		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting		None
MUB2004P	Human BMI1	229F6	Tumour marker		Human,Mouse,Rabbit,Rat		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunoprecipitation,Western blotting		None
MUB2004S	Human BMI1	229F6	Tumour marker		Human,Mouse,Rabbit,Rat		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunoprecipitation,Western blotting		None
MUB2001S	Human CD11b/C3	Bear-1	CD markers, Cell adhesion		Human		Supernatant monoclonal antibody	Flow Cytometry,Immunoprecipitation		None
MUB2001P	Human CD11b/C3	Bear-1	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunoprecipitation		None
MUB2010P	Human CD20	NKI-B20	CD markers		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation		None
MUB2014P	Human HLA DQ	NKI(SPV)L3	Haematology		Human,Swine		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation		None
MUB1907P	Human vitronectin receptor (CD51)	NKI-M9 (former PAF2a)	CD markers, Cell adhesion	NKI-M9 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 cells with spleen cells from a Balb/c mouse immunized with human melanoma cells. NKI-M9 reacts with CD51. CD51 is a type I integral membrane glycoprotein, known as vitronectin receptor a chain, or integrin aV. It forms heterodimer with integrin b1 (CD29), b3 (CD61), b5, b6, or b8. CD51 contains two disulfide-linked subunits of 125 kD and 24 kD, and is expressed on endothelial cells, fibroblasts, macrophages, platelets, osteoclasts, neuroblastoma, melanoma, and hepatoma cells. Many extracellular matrix proteins with RGD-motifs are CD51 ligands. In association with its b chains, CD51 binds vitronectin, von Willebrand factor, fibronectin, thrombospondin, osteopontin, fibrinogen, and laminin. CD51, as an adhesion molecule, plays important roles in leukocytes homing and rolling, mediates boneabsorption and angiogenesis.	Human		Purified monoclonal antibody	Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation	Cancer,Cell adhesion,Immunology,Neurobiology,Stem cell research	None
MUB1907S	Human vitronectin receptor (CD51)	NKI-M9 (former PAF2a)	CD markers, Cell adhesion	NKI-M9 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 cells with spleen cells from a Balb/c mouse immunized with human melanoma cells. NKI-M9 reacts with CD51. CD51 is a type I integral membrane glycoprotein, known as vitronectin receptor a chain, or integrin aV. It forms heterodimer with integrin b1 (CD29), b3 (CD61), b5, b6, or b8. CD51 contains two disulfide-linked subunits of 125 kD and 24 kD, and is expressed on endothelial cells, fibroblasts, macrophages, platelets, osteoclasts, neuroblastoma, melanoma, and hepatoma cells. Many extracellular matrix proteins with RGD-motifs are CD51 ligands. In association with its b chains, CD51 binds vitronectin, von Willebrand factor, fibronectin, thrombospondin, osteopontin, fibrinogen, and laminin. CD51, as an adhesion molecule, plays important roles in leukocytes homing and rolling, mediates boneabsorption and angiogenesis.	Human		Supernatant monoclonal antibody	Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation	Cancer,Cell adhesion,Immunology,Neurobiology,Stem cell research	None
MUB2011P	human vitronectin receptor CD51	NKI-M7 (former AMF7)	Cell adhesion, CD marker		Human		Purified monoclonal antibody			None
MUB3107L5	IFN-g, labeled with Phycoerythrin	45-14	Isotype control		Human		Purified monoclonal antibody			Phycoerythrin
MUB3107P3	IFN-g	45-14	Isotype control		Human		Purified monoclonal antibody			None
MUB3107L6	IFN-g, labeled with Allephycocyanin	45-14	Isotype control		Human		Purified monoclonal antibody			Allephycocyanin
MUB3107L1	IFN-g, labeled with Fluorescein Isothiocyanate	45-14	Isotype control		Human		Purified monoclonal antibody			Fluorescein Isothiocyanate
MUB3107P2	IFN-g	45-14	Isotype control		Human		Purified monoclonal antibody			None
MUB3108L1	IgG1, labeled with Fluorescein Isothiocyanate	MCG1	Isotype control		Mouse		Isotype control	Flow Cytometry		Fluorescein Isothiocyanate
MUB3108L5	IgG1, labeled with Phycoerythrin	MCG1	Isotype control		Mouse		Isotype control	Flow Cytometry		Phycoerythrin
MUB3108P1	IgG1	MCG1	Isotype control		Mouse		Isotype control	Flow Cytometry		None
MUB3108L7	IgG1, labeled with Cyanine 5.18 and Phycoerythrin	MCG1	Isotype control		Mouse		Isotype control	Flow Cytometry		Cyanine 5.18 and Phycoerythrin
MUB3108L6	IgG1, labeled with Allephycocyanin	MCG1	Isotype control		Mouse		Isotype control	Flow Cytometry		Allephycocyanin
MUB3109L6	IgG2a, labeled with Allephycocyanin	MCG2a	Isotype control		Mouse		Isotype control	Flow Cytometry		Allephycocyanin
MUB3109P1	IgG2a	MCG2a	Isotype control		Mouse		Isotype control	Flow Cytometry		None
MUB3109L1	IgG2a, labeled with Fluorescein Isothiocyanate	MCG2a	Isotype control		Mouse		Isotype control	Flow Cytometry		Fluorescein Isothiocyanate
MUB3109L7	IgG2a, labeled with Cyanine 5.18 and Phycoerythrin	MCG2a	Isotype control		Mouse		Isotype control	Flow Cytometry		Cyanine 5.18 and Phycoerythrin
MUB3109L5	IgG2a, labeled with Phycoerythrin	MCG2a	Isotype control		Mouse		Isotype control	Flow Cytometry		Phycoerythrin
MUB3110L1	IgG2b, labeled with Fluorescein Isothiocyanate	MCG2b	Isotype control		Mouse		Isotype control	Flow Cytometry,Immunocytochemistry		Fluorescein Isothiocyanate
MUB3110P1	IgG2b	MCG2b	Isotype control		Mouse		Isotype control	Flow Cytometry,Immunocytochemistry		None
MUB3110L5	IgG2b, labeled with Phycoerythrin	MCG2b	Isotype control		Mouse		Isotype control	Flow Cytometry,Immunocytochemistry		Phycoerythrin
MUB0900P	Integrin α3A	29A3	Cell adhesion	29A3 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. 29A3 recognizes specifically the cytoplasmic domain of integrin subunit α3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0901P	Integrin α3A	158A3	Cell adhesion	158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit α3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0901S	Integrin α3A	158A3	Cell adhesion	158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit α3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0900S	Integrin α3A	29A3	Cell adhesion	29A3 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. 29A3 recognizes specifically the cytoplasmic domain of integrin subunit α3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0902P	Integrin α3B	54B3	Cell adhesion	54B3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. 54B3 recognizes specifically the cytoplasmic domain of integrin subunit α3B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0902S	Integrin α3B	54B3	Cell adhesion	54B3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. 54B3 recognizes specifically the cytoplasmic domain of integrin subunit α3B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0903P	Integrin α3B+α6B	PB36	Cell adhesion	PB36 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. PB36 recognizes the cytoplasmic domain of integrin subunits α3B and α6B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0903S	Integrin α3B+α6B	PB36	Cell adhesion	PB36 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. PB36 recognizes the cytoplasmic domain of integrin subunits α3B and α6B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0910S	Integrin α5 (CD49e)	NKI-SAM-1	CD markers, Cell adhesion	NKI-SAM-1 is a mouse monoclonal IgG2b antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Balb/c mouse immunized with the U937 cell line of human origin. Sam-1 reacts with Integrin alpha 5 (CD49e). Integrin Alpha 5 belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Integrin Alpha 5 undergoes post translational cleavage in the extracellular domain to yield disulfide linked light and heavy chains that join with the integrin beta 1 (CD29) unit to form a fibronectin receptor, also known as the very late activation antigen-5 (VLA-5) complex. Integrin alpha 5 is expressed on thymocytes, T cells, monocytes, platelets, early B cells, and activated B cells.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation	Cell adhesion,Immunology	None
MUB0910P	Integrin α5 (CD49e)	NKI-SAM-1	CD markers, Cell adhesion	NKI-SAM-1 is a mouse monoclonal IgG2b antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Balb/c mouse immunized with the U937 cell line of human origin. Sam-1 reacts with Integrin alpha 5 (CD49e). Integrin Alpha 5 belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Integrin Alpha 5 undergoes post translational cleavage in the extracellular domain to yield disulfide linked light and heavy chains that join with the integrin beta 1 (CD29) unit to form a fibronectin receptor, also known as the very late activation antigen-5 (VLA-5) complex. Integrin alpha 5 is expressed on thymocytes, T cells, monocytes, platelets, early B cells, and activated B cells.	Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation	Cell adhesion,Immunology	None
MUB0904S	Integrin α6A	1A10	Cell adhesion	1A10 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the C- terminal 28 amino acids of integrin α6A including an appending N-terminal cysteine (CKKDHYDATYHKAEIHAQPSDKERLTSDA) coupled to keyhole limpet hemocyanin. 1A10 reacts exclusively the cytoplasmic domain of non-phosphorylated integrin subunit α6A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0904P	Integrin α6A	1A10	Cell adhesion	1A10 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the C- terminal 28 amino acids of integrin α6A including an appending N-terminal cysteine (CKKDHYDATYHKAEIHAQPSDKERLTSDA) coupled to keyhole limpet hemocyanin. 1A10 reacts exclusively the cytoplasmic domain of non-phosphorylated integrin subunit α6A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0908S	Integrin α6A / CD49f	NKI-GoH3	CD markers, Cell adhesion	NKI-GoH3 is a rat monoclonal IgG2a raised against an extracellular epitope of integrin a6 of human origin. The antibody is derived by fusion of cells of the SP2/0 mouse myeloma cell line and spleen cells from Sprague-Dawley rats immunized with mouse Balb/c mammary tumour cells. NKI-GoH3 is directed against the CDw49f-antigen, 120kD, (GP Ic or VLA-6 alpha-chain), which can form distinct complexes with either the CD29-antigen (GP 11a or VLA beta-chain), resulting in the VLA-6 (alpha-6 beta-1) complex, expressed on human platelets, or with the beta-4 integrin antigen, resulting in the alpha-6 beta-4 complex expressed on various human epithelial cells. The monoclonal antibody reacts with platelets, megakaryocytes, T lymphocytes and common Acute Lymphoblastic Leukaemia cells (alpha-6 beta-1). In immunohistology the monoclonal antibody reacts with epithelial cells of a variety of tissues, peripheral nerves, microvascular endothelial cells, placenta cyto- and syncytiotrophoblasts.	Human,Mouse		Supernatant monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation	Cell adhesion,Immunology	None
MUB0908P	Integrin α6A / CD49f	NKI-GoH3	CD markers, Cell adhesion	NKI-GoH3 is a rat monoclonal IgG2a raised against an extracellular epitope of integrin a6 of human origin. The antibody is derived by fusion of cells of the SP2/0 mouse myeloma cell line and spleen cells from Sprague-Dawley rats immunized with mouse Balb/c mammary tumour cells. NKI-GoH3 is directed against the CDw49f-antigen, 120kD, (GP Ic or VLA-6 alpha-chain), which can form distinct complexes with either the CD29-antigen (GP 11a or VLA beta-chain), resulting in the VLA-6 (alpha-6 beta-1) complex, expressed on human platelets, or with the beta-4 integrin antigen, resulting in the alpha-6 beta-4 complex expressed on various human epithelial cells. The monoclonal antibody reacts with platelets, megakaryocytes, T lymphocytes and common Acute Lymphoblastic Leukaemia cells (alpha-6 beta-1). In immunohistology the monoclonal antibody reacts with epithelial cells of a variety of tissues, peripheral nerves, microvascular endothelial cells, placenta cyto- and syncytiotrophoblasts.	Human,Mouse		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation	Cell adhesion,Immunology	None
MUB0905S	Integrin α6B	6B4	Cell adhesion	6B4 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 34 amino acid stretch in the cytoplasmic domain of integrin α6B including an appending N-terminal cysteine: CSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKK coupled to keyhole limpet hemocyanin. 6B4 recognizes specifically the cytoplasmic domain of integrin subunit α6B. The monoclonal antibody reacts with Human tissues, and a broad species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0905P	Integrin α6B	6B4	Cell adhesion	6B4 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 34 amino acid stretch in the cytoplasmic domain of integrin α6B including an appending N-terminal cysteine: CSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKK coupled to keyhole limpet hemocyanin. 6B4 recognizes specifically the cytoplasmic domain of integrin subunit α6B. The monoclonal antibody reacts with Human tissues, and a broad species reactivity is expected because of the conserved nature of the epitope.	Human	A broad species reactivity is expected because of the conserved nature of the epitope.	Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB0907P	Integrin β1D	1G2	Cell adhesion	1G2 is a mouse monoclonal IgG2a, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to the Cterminal 24 amino acids of integrin β1D including an appending N-terminal cysteine (CQENPIYKSPINNFKNPNYGRKAGL) coupled to keyhole limpet hemocyanin. 1G2 recognizes specifically the cytoplasmic domain of integrin subunit β1D present in cardiac and skeletal muscle. The monoclonal antibody reacts with Human and mouse tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human,Mouse	A broad species reactivity is expected because of the conserved nature of the epitope.	Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cardiovascular,Cell adhesion	None
MUB0907S	Integrin β1D	1G2	Cell adhesion	1G2 is a mouse monoclonal IgG2a, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to the Cterminal 24 amino acids of integrin β1D including an appending N-terminal cysteine (CQENPIYKSPINNFKNPNYGRKAGL) coupled to keyhole limpet hemocyanin. 1G2 recognizes specifically the cytoplasmic domain of integrin subunit β1D present in cardiac and skeletal muscle. The monoclonal antibody reacts with Human and mouse tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Human,Mouse	A broad species reactivity is expected because of the conserved nature of the epitope.	Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cardiovascular,Cell adhesion	None
MUB0906S	Integrin β1D	2B1	Cell adhesion	2B1 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to the C-terminal 24 amino acids of integrin β1D including an appending N-terminal cysteine (CQENPIYKSPINNFKNPNYGRKAGL) coupled to keyhole limpet hemocyanin. 2B1 recognizes specifically the cytoplasmic domain of integrin subunit β1D present in cardiac and skeletal muscle. The monoclonal antibody reacts with Human, mouse and dog tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Canine,Human,Mouse,Swine	A broad species reactivity is expected because of the conserved nature of the epitope.	Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cardiovascular,Cell adhesion	None
MUB0906P	Integrin β1D	2B1	Cell adhesion	2B1 is a mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to the C-terminal 24 amino acids of integrin β1D including an appending N-terminal cysteine (CQENPIYKSPINNFKNPNYGRKAGL) coupled to keyhole limpet hemocyanin. 2B1 recognizes specifically the cytoplasmic domain of integrin subunit β1D present in cardiac and skeletal muscle. The monoclonal antibody reacts with Human, mouse and dog tissues. A broader species reactivity is expected because of the conserved nature of the epitope.	Canine,Human,Mouse,Swine	A broad species reactivity is expected because of the conserved nature of the epitope.	Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cardiovascular,Cell adhesion	None
MUB0909P	Integrin β4 (CD104)	58XB4	Cell adhesion, Cell cycle markers	The monoclonal antibody clone 58X4 is a monoclonal antibody specific for integrin beta 4 (CD104). The immunogen used to raise this antibody was the full length CD104 protein. CD104 is a 205 kD type I transmembrane glycoprotein, known as integrin β4 chain or β4 integrin. Integrin b4 associates with integrin α6 (CD49f) forming the α6/β4 (CD49f/CD104) heterodimer. CD104 is expressed on epithelial cells (especially on the proliferative basal layer epithelial cells in skin), endothelial cells, Schwann cells, certain tumor cells and a subset of pre-T cells. CD49f/CD104 is an adhesion receptor for laminins (especially laminin 5) and keratin filaments and is involved in the regulation of hemidesmosome formation and of cell proliferation and activation.	Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion	None
MUB0909S	Integrin β4 (CD104)	58XB4	Cell adhesion, Cell cycle markers	The monoclonal antibody clone 58X4 is a monoclonal antibody specific for integrin beta 4 (CD104). The immunogen used to raise this antibody was the full length CD104 protein. CD104 is a 205 kD type I transmembrane glycoprotein, known as integrin β4 chain or β4 integrin. Integrin b4 associates with integrin α6 (CD49f) forming the α6/β4 (CD49f/CD104) heterodimer. CD104 is expressed on epithelial cells (especially on the proliferative basal layer epithelial cells in skin), endothelial cells, Schwann cells, certain tumor cells and a subset of pre-T cells. CD49f/CD104 is an adhesion receptor for laminins (especially laminin 5) and keratin filaments and is involved in the regulation of hemidesmosome formation and of cell proliferation and activation.	Human		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion	None
MUB0305S	K-Cadherin/Cadherin-6	2B6	Cell adhesion	2B6 is a mouse monoclonal IgG1 antibody obtained by fusion of SP2/0 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with affinity purified extracellular domain of human cadherin-6-GST fusion protein. 2B6 recognizes the extracellular domain of cadherin-6.	Human,Rat		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell adhesion	None
MUB0305P	K-Cadherin/Cadherin-6	2B6	Cell adhesion	2B6 is a mouse monoclonal IgG1 antibody obtained by fusion of SP2/0 mouse myeloma cells with spleen cells from a BABL/c mouse immunized with affinity purified extracellular domain of human cadherin-6-GST fusion protein. 2B6 recognizes the extracellular domain of cadherin-6.	Human,Rat		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell adhesion	None
MUB2003P	Lactoferrin	67F12	Tumour marker		Human,Mouse		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB2002S	Lactoferrin	67D9	Tumour marker		Human,Mouse		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB2002P	Lactoferrin	67D9	Tumour marker		Human,Mouse		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB1101S	Lamin A	133A2	Nuclear proteins	133A2 is a mouse monoclonal IgG3/κ antibody obtained from fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with partially purified recombinant human lamin A. 133A2 recognizes an epitope located between residues 598-611 of lamin A and therefore 133A2 reacts exclusively with lamin A.	Bovine,Canine,Human,Mouse,Rat		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cytoskeleton	None
MUB1101P	Lamin A	133A2	Nuclear proteins	133A2 is a mouse monoclonal IgG3/κ antibody obtained from fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with partially purified recombinant human lamin A. 133A2 recognizes an epitope located between residues 598-611 of lamin A and therefore 133A2 reacts exclusively with lamin A.	Bovine,Canine,Human,Mouse,Rat		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cytoskeleton	None
MUB1102P	Lamin A and C	131C3	Nuclear proteins	131C3 is a mouse monoclonal IgG1/κ antibody derived by fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with purified rat liver lamins. 131C3 reacts with an epitope located between residues 319-566 in lamin A and C.	Bovine,Canine,Hamster,Human,Mouse,Rat,Sheep		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cytoskeleton	None
MUB1102S	Lamin A and C	131C3	Nuclear proteins	131C3 is a mouse monoclonal IgG1/κ antibody derived by fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with purified rat liver lamins. 131C3 reacts with an epitope located between residues 319-566 in lamin A and C.	Bovine,Canine,Hamster,Human,Mouse,Rat,Sheep		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cytoskeleton	None
MUB1103S	Lamin B1	119D5-F1	Nuclear proteins	119D5-F1 is a mouse monoclonal IgG1/κ antibody derived by fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with purified rat liver lamins. 119D5-F1 reacts with an epitope located C-terminal of residue 231 in lamin B1.	Bovine,Canine,Human,Mouse,Rabbit,Rat,Sheep		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Western blotting	Cytoskeleton	None
MUB1103P	Lamin B1	119D5-F1	Nuclear proteins	119D5-F1 is a mouse monoclonal IgG1/κ antibody derived by fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with purified rat liver lamins. 119D5-F1 reacts with an epitope located C-terminal of residue 231 in lamin B1.	Bovine,Canine,Human,Mouse,Rabbit,Rat,Sheep		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Western blotting	Cytoskeleton	None
MUB1104P	Lamin B2	LN43	Nuclear proteins	LN43 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with the detergent insoluble fraction of potoroo cell line PtK1. LN43 reacts with an epitope located in the C-terminal part of lamin B2.	Hamster,Human,Mouse,Swine,Xenopus,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Western blotting	Cytoskeleton	None
MUB1104S	Lamin B2	LN43	Nuclear proteins	LN43 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with the detergent insoluble fraction of potoroo cell line PtK1. LN43 reacts with an epitope located in the C-terminal part of lamin B2.	Hamster,Human,Mouse,Swine,Xenopus,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Western blotting	Cytoskeleton	None
MUB1105P	Lamin C	Polyclonal	Nuclear proteins	RaLC is an affinity purified rabbit polyclonal antibody raised against the last eight C-terminal amino acids of lamin C, including an N-terminal lysine as a linker (KHHVSGSRR) coupled to keyhole limpet haemocyanin. RaLC reacts exclusively with lamin C.	Human		Purified polyclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Western blotting	Cytoskeleton	None
MUB1105S	Lamin C	Polyclonal	Nuclear proteins	RaLC is an affinity purified rabbit polyclonal antibody raised against the last eight C-terminal amino acids of lamin C, including an N-terminal lysine as a linker (KHHVSGSRR) coupled to keyhole limpet haemocyanin. RaLC reacts exclusively with lamin C.	Human		Supernatant polyclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Western blotting	Cytoskeleton	None
MUB1107S	Laminin	Polyclonal	Cell adhesion, Extracellular matrix		Human,Mouse		Unpurified polyclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1100P	Laminin	A5	Cell adhesion, Extracellular matrix	A5 is a rat monoclonal IgG2a antibody derived by fusion of mouse myeloma cells with spleen cells from a Fisher rat immunized with a laminin preparation from the EHS mouse tumor. A5 reacts with laminin.	Human,Mouse		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen	Cancer	None
MUB1109S	LH-RH	Polyclonal	Hormones		Human		Unpurified polyclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1202S	Lung Cancer-associated Antigen MOC-31/ CD56	MOC-31	CD markers, Tumour marker	MOC31 is a monoclonal derived from a mouse immunized with an immunogen isolated from small cell lung carcinoma-derived cell line. During the First International Workshop on Small Cell Lung Cancer Antigens in London, April 1987, specific antibodies have been catagorized according to their reactivity patterns. MOC-31 belongs to the so-called 'cluster 2' reactivity pattern. In Western blotting the antibody reacts with a 40 kD membrane-associated protein present in most epithelia and in all lung carcinomas.	Human,Mouse		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer	None
MUB1202P	Lung Cancer-associated Antigen MOC-31/ CD56	MOC-31	CD markers, Tumour marker	MOC31 is a monoclonal derived from a mouse immunized with an immunogen isolated from small cell lung carcinoma-derived cell line. During the First International Workshop on Small Cell Lung Cancer Antigens in London, April 1987, specific antibodies have been catagorized according to their reactivity patterns. MOC-31 belongs to the so-called 'cluster 2' reactivity pattern. In Western blotting the antibody reacts with a 40 kD membrane-associated protein present in most epithelia and in all lung carcinomas.	Human,Mouse		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer	None
MUB0605S	M13 phage coat protein	RL-ph3	Filamentous phage	RL-ph3 is a mouse monoclonal IgM, κ antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with isolated M13 phage coat proteins. RL-ph3 reacts with the major M13 filamentous phage coat protein g8p with a molecular weight of 5 kDa.	Not applicable		Supernatant monoclonal antibody	Western blotting		None
MUB0605P	M13 phage coat protein	RL-ph3	Filamentous phage	RL-ph3 is a mouse monoclonal IgM, κ antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with isolated M13 phage coat proteins. RL-ph3 reacts with the major M13 filamentous phage coat protein g8p with a molecular weight of 5 kDa.	Not applicable		Purified monoclonal antibody	Western blotting		None
MUB0603P	M13 phage coat protein g8p	RL-ph1	Filamentous phage	RL-ph1 is a mouse monoclonal IgG2b, κ antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with isolated M13 phage coat proteins. RL-ph1 reacts with the major M13 filamentous phage coat protein g8p with a molecular weight of 5 kDa.	Not applicable		Purified monoclonal antibody	Affinity chromatography,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB0604S	M13 phage coat protein g8p	RL-ph2	Filamentous phage	RL-ph2 is a mouse monoclonal IgG2a, κ antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with isolated M13 phage coat proteins. RL-ph2 reacts with the major M13 filamentous phage coat protein g8p with a molecular weight of 5 kDa.	Not applicable		Supernatant monoclonal antibody	Affinity chromatography,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB0603S	M13 phage coat protein g8p	RL-ph1	Filamentous phage	RL-ph1 is a mouse monoclonal IgG2b, κ antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with isolated M13 phage coat proteins. RL-ph1 reacts with the major M13 filamentous phage coat protein g8p with a molecular weight of 5 kDa.	Not applicable		Supernatant monoclonal antibody	Affinity chromatography,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB0604P	M13 phage coat protein g8p	RL-ph2	Filamentous phage	RL-ph2 is a mouse monoclonal IgG2a, κ antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with isolated M13 phage coat proteins. RL-ph2 reacts with the major M13 filamentous phage coat protein g8p with a molecular weight of 5 kDa.	Not applicable		Purified monoclonal antibody	Affinity chromatography,Flow Cytometry,Immunocytochemistry,Western blotting		None
MUB1209S	Melanoma Associated Antigen	NKI-Beteb	Tumour marker	NKI-Beteb is a mouse monoclonal IgG2b antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Balb/c mice immunized with a smooth membrane fraction of a lymph node metastasis of melanoma. MIK-Beteb reacts with Melanoma Associated Antigen, a glycoprotein of 100 + 7 kDa. Melanoma associated antigen (MAA) is dispersed in the cytoplasma of melanoma cells, and is more concentrated inside vacuoles and sometimes on the melanosomes. Occasionally the antigen is seen on the cell surface. The antigen is actively shed from living cells. Melanoma Associated Antigen 100 + 7 kDa is present in melanomas, clear cells sarcomas (melanoma of soft tissue), nevocellular nevi, and normal melanocytes. Except for one case of non Hodgkin's lymphoma in which macrophages were positive, the antigen has not been detected with other tumors or tissues observed.	Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin	Cancer	None
MUB1205S	Melanoma Associated Antigen	NKI-C3	Tumour marker		Human		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Immunofluorescence,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1205P	Melanoma Associated Antigen	NKI-C3	Tumour marker		Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Immunofluorescence,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1209P	Melanoma Associated Antigen	NKI-Beteb	Tumour marker	NKI-Beteb is a mouse monoclonal IgG2b antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a Balb/c mice immunized with a smooth membrane fraction of a lymph node metastasis of melanoma. MIK-Beteb reacts with Melanoma Associated Antigen, a glycoprotein of 100 + 7 kDa. Melanoma associated antigen (MAA) is dispersed in the cytoplasma of melanoma cells, and is more concentrated inside vacuoles and sometimes on the melanosomes. Occasionally the antigen is seen on the cell surface. The antigen is actively shed from living cells. Melanoma Associated Antigen 100 + 7 kDa is present in melanomas, clear cells sarcomas (melanoma of soft tissue), nevocellular nevi, and normal melanocytes. Except for one case of non Hodgkin's lymphoma in which macrophages were positive, the antigen has not been detected with other tumors or tissues observed.	Human		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin	Cancer	None
MUB1200S	Mitotic cells	8B3G	Cell cycle markers	8B3G is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a total cell lysate of the human bladder carcinoma cell line T24. 8B3G strongly stains mitotic cells and can therefore be used in flow cytometric analyses of cell suspensions to detect the mitotic index. Dynamic information can be obtained by combining BrdU incorporation with 8B3G staining, which can distinguish and quantitate the four major fractions of the cell cycle.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry	Cell cycle,Cell proliferation	None
MUB1200P	Mitotic cells	8B3G	Cell cycle markers	8B3G is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a total cell lysate of the human bladder carcinoma cell line T24. 8B3G strongly stains mitotic cells and can therefore be used in flow cytometric analyses of cell suspensions to detect the mitotic index. Dynamic information can be obtained by combining BrdU incorporation with 8B3G staining, which can distinguish and quantitate the four major fractions of the cell cycle.	Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry	Cell cycle,Cell proliferation	None
MUB3124P1	MNDA	3C1	Isotype control		Human		Purified monoclonal antibody			None
MUB3124L1	MNDA, labeled with Fluorescein Isothiocyanate	3C1	Isotype control		Human		Purified monoclonal antibody			Fluorescein Isothiocyanate
MUB3124S1	MOC-1	MOC-1	Isotype control		Human		Supernatant monoclonal antibody			None
MUB1201S	MOC-1 / CD56	MOC-1	CD markers, Tumour marker	MOC1 is a monoclonal derived from a mouse immunized with an immunogen isolated from small cell lung carcinoma-derived cell line. MOC-1 reacts with 125 kD and 145 kD membrane-associated proteins in normal and malignant neu-roendocrine tissues including SCLC.	Human,Mouse		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB1201P	MOC-1 / CD56	MOC-1	CD markers, Tumour marker	MOC1 is a monoclonal derived from a mouse immunized with an immunogen isolated from small cell lung carcinoma-derived cell line. MOC-1 reacts with 125 kD and 145 kD membrane-associated proteins in normal and malignant neu-roendocrine tissues including SCLC.	Human,Mouse		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Cell adhesion	None
MUB1203S	MT1 / CD43	MT1	CD markers	MT1 is a monoclonal derived from a mouse immunized with an immunogen isolated from human lymph node cells. CD43 is a 95/100 – 135 kD cell-surface glycoprotein, expressed in high amounts on all leucocytes (except most resting B-lymphocytes). MT1 is a marker for acute lymphoblastic lymphomas.	Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Immunology	None
MUB1203P	MT1 / CD43	MT1	CD markers	MT1 is a monoclonal derived from a mouse immunized with an immunogen isolated from human lymph node cells. CD43 is a 95/100 – 135 kD cell-surface glycoprotein, expressed in high amounts on all leucocytes (except most resting B-lymphocytes). MT1 is a marker for acute lymphoblastic lymphomas.	Human		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Immunology	None
MUB1206S	MUC1 (CD227)	139H2	CD markers, Cell adhesion	139H2 is a mouse monoclonal antibody against MUC-1, a large transmembrane glycoprotein expressed on the ductal surface of normal glandular epithelia. The antibody is raised in Balb/c mice, the mice were immunized with deglycosylated purified MUC-1 glycoprotein. Splenocytes of immunized mice were fused with SP2/0 cells. The epitope specificity of the 139H2 monoclonal antibody has not yet been determined. The extracellular domain of MUC-1 largely consists of of a highly conserved O-glycosylated 20 AA variable number tandem repeat (VNTR) domain which can occur 20-120 times per molecule depending on the length of the allelin involved. The protein serves a protective function by binding to pathogens and also functions in a cell signalling capacity. Overexpression, abberrant intracellular localization and changes in glycosylation of this protein have been associated with carcinomas.	Human		Supernatant monoclonal antibody	Electron microscopy,Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cancer,Cell adhesion	None
MUB1207P	MUC1 (CD227)	175C5	CD markers, Cell adhesion	175C5 is a MUC-1 mouse monolconal antibody directed against a peptide of MUC-1. The antibody shows no reaction with the 20 AA peptide corresponding to 1 repeat of the MUC-1 protein core, but reacts with the 40-60 mer peptides corresponding to 2-3 tandem repeats of the core protein. The antibody shows a high preference for breast carcinomas relative to normal breast epithelium.	Human		Purified monoclonal antibody	Electron microscopy,Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cancer,Cell adhesion	None
MUB1207S	MUC1 (CD227)	175C5	CD markers, Cell adhesion	175C5 is a MUC-1 mouse monolconal antibody directed against a peptide of MUC-1. The antibody shows no reaction with the 20 AA peptide corresponding to 1 repeat of the MUC-1 protein core, but reacts with the 40-60 mer peptides corresponding to 2-3 tandem repeats of the core protein. The antibody shows a high preference for breast carcinomas relative to normal breast epithelium.	Human		Supernatant monoclonal antibody	Electron microscopy,Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cancer,Cell adhesion	None
MUB1206P	MUC1 (CD227)	139H2	CD markers, Cell adhesion	139H2 is a mouse monoclonal antibody against MUC-1, a large transmembrane glycoprotein expressed on the ductal surface of normal glandular epithelia. The antibody is raised in Balb/c mice, the mice were immunized with deglycosylated purified MUC-1 glycoprotein. Splenocytes of immunized mice were fused with SP2/0 cells. The epitope specificity of the 139H2 monoclonal antibody has not yet been determined. The extracellular domain of MUC-1 largely consists of of a highly conserved O-glycosylated 20 AA variable number tandem repeat (VNTR) domain which can occur 20-120 times per molecule depending on the length of the allelin involved. The protein serves a protective function by binding to pathogens and also functions in a cell signalling capacity. Overexpression, abberrant intracellular localization and changes in glycosylation of this protein have been associated with carcinomas.	Human		Purified monoclonal antibody	Electron microscopy,Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cancer,Cell adhesion	None
MUB2006P	MUC-1 (CD227)	214D4	CD markers, Cell adhesion		Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB2006S	MUC-1 (CD227)	214D4	CD markers, Cell adhesion		Human		Supernatant monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1321S	NCAM (CD56)	NKI-nbl-1	CD markers, Cell adhesion	This clone NIK-nbl-1 has been derived from hybridization of SP2/0 cells with spleen cells of a Balb/c mouse immunized with neuroblastoma cells. The antibody recognizes a heterodimeric glycoprotein of 145, 185 kD which has been identified as NCAM (Neural Cell Adhesion Molecule). Two major epitopes have been defined, NKI-nbl-1 reacts with epitope 1 and 123C3 reacts with epitope 2. NCAM, as a member of the immunoglobulin superfamily of adhesion molecules, characterized by several immunoglobulin (Ig)-like domains. The extracellular part of NCAM consists of five Ig domains and two fibronectin type III homology regions. NCAM is encoded by a single copy gene composed of 26 exons. Different isoforms can be generated by alternative splicing and by posttranslational modifications, such as sialylation. Through its extracellular region, NCAM mediates homophilic interactions. In addition, NCAM can also undergo heterophilic interactions by binding extracellular matrix components, such as laminin, or other cell adhesion molecules, such as integrins. The nbl-1 antibody reacts with NCAM ecpressed on human NK cells, T cells and neuro-ectodermal cells. NKI-nbl-1 does not react with human granulocytes, monocytes and B lymphocytes.	Human		Supernatant monoclonal antibody	Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation	Cancer,Neurobiology,Stem cell research	None
MUB1321P	NCAM (CD56)	NKI-nbl-1	CD markers, Cell adhesion	This clone NIK-nbl-1 has been derived from hybridization of SP2/0 cells with spleen cells of a Balb/c mouse immunized with neuroblastoma cells. The antibody recognizes a heterodimeric glycoprotein of 145, 185 kD which has been identified as NCAM (Neural Cell Adhesion Molecule). Two major epitopes have been defined, NKI-nbl-1 reacts with epitope 1 and 123C3 reacts with epitope 2. NCAM, as a member of the immunoglobulin superfamily of adhesion molecules, characterized by several immunoglobulin (Ig)-like domains. The extracellular part of NCAM consists of five Ig domains and two fibronectin type III homology regions. NCAM is encoded by a single copy gene composed of 26 exons. Different isoforms can be generated by alternative splicing and by posttranslational modifications, such as sialylation. Through its extracellular region, NCAM mediates homophilic interactions. In addition, NCAM can also undergo heterophilic interactions by binding extracellular matrix components, such as laminin, or other cell adhesion molecules, such as integrins. The nbl-1 antibody reacts with NCAM ecpressed on human NK cells, T cells and neuro-ectodermal cells. NKI-nbl-1 does not react with human granulocytes, monocytes and B lymphocytes.	Human		Purified monoclonal antibody	Immunofluorescence,Immunohistochemistry frozen ,Immunoprecipitation	Cancer,Neurobiology,Stem cell research	None
MUB1301S	NCAM / CD56	123C3	CD markers, Cell adhesion	123C3 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with the a membrane preparation of a small cell lung carcinoma specimen. 123C3 was defined as a cluster I antibody during the First International Workshop on Small Cell Lung Cancer (SCLC) Antibodies. 123C3 recognizes an epitope in the NCAM exons 11-13 which is dependent on an intact conformation of the first fibronectin type-III homologous domain encoded by these exons	Human		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell adhesion,Neurobiology	None
MUB1300P	NCAM / CD56	RNL-1	CD markers, Cell adhesion	RNL-1 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the small cell lung cancer cell line NCI-H82. RNL-1 was defined as a cluster I antibody during the Second International Workshop on Small Cell Lung Cancer (SCLC) Antibodies. RNL-1 recognizes NCAM which is present in small cell lung cancer (SCLC) and lung carcinoids.	Human,Mouse		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen	Cancer,Cell adhesion,Neurobiology	None
MUB1301P	NCAM / CD56	123C3	CD markers, Cell adhesion	123C3 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with the a membrane preparation of a small cell lung carcinoma specimen. 123C3 was defined as a cluster I antibody during the First International Workshop on Small Cell Lung Cancer (SCLC) Antibodies. 123C3 recognizes an epitope in the NCAM exons 11-13 which is dependent on an intact conformation of the first fibronectin type-III homologous domain encoded by these exons	Human		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cell adhesion,Neurobiology	None
MUB1300S	NCAM / CD56	RNL-1	CD markers, Cell adhesion	RNL-1 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the small cell lung cancer cell line NCI-H82. RNL-1 was defined as a cluster I antibody during the Second International Workshop on Small Cell Lung Cancer (SCLC) Antibodies. RNL-1 recognizes NCAM which is present in small cell lung cancer (SCLC) and lung carcinoids.	Human,Mouse		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen	Cancer,Cell adhesion,Neurobiology	None
MUB1317P	Nesprin	Nsp-3	Membrane	NSP-3 is a mouse monoclonal antibody made by immunisation of Balb/c mice with the GST fusion protein encoding the seventh spectrin repeat of nesprin-3a. Nesprin-3 is a type II transmembrane protein of the outer nuclear membrane and contains a COOH-terminal klarsicht/ANC/syne (KASH) homology domain and a series of spectrin repeats (SRs) related to those in nesprin-1 and nesprin-2. Nesprin-3 has two isoforms, nesprin-3 a and nesprin-3b which differ in their N-termini. Nesprin-3 is smaller then nesprin-1 and nesprin-2 (116 kDa) and lacks an N-terminal actin-binding domain (ABD).	Mouse		Purified monoclonal antibody	Immunohistochemistry frozen	Cytoskeleton	None
MUB1317S	Nesprin	Nsp-3	Membrane	NSP-3 is a mouse monoclonal antibody made by immunisation of Balb/c mice with the GST fusion protein encoding the seventh spectrin repeat of nesprin-3a. Nesprin-3 is a type II transmembrane protein of the outer nuclear membrane and contains a COOH-terminal klarsicht/ANC/syne (KASH) homology domain and a series of spectrin repeats (SRs) related to those in nesprin-1 and nesprin-2. Nesprin-3 has two isoforms, nesprin-3 a and nesprin-3b which differ in their N-termini. Nesprin-3 is smaller then nesprin-1 and nesprin-2 (116 kDa) and lacks an N-terminal actin-binding domain (ABD).	Mouse		Supernatant monoclonal antibody	Immunohistochemistry frozen	Cytoskeleton	None
MUB1302P	Nestin	10C2	Cytoskeletal	Nestin (clone 10C2) is a monoclonal antibody derived by traditional hybridoma technology. A 150-amino-acid fragment from the cloned human nestin was conjugated to glutathione S-transferase and used as an immunogen.	Human		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1302S	Nestin	10C2	Cytoskeletal	Nestin (clone 10C2) is a monoclonal antibody derived by traditional hybridoma technology. A 150-amino-acid fragment from the cloned human nestin was conjugated to glutathione S-transferase and used as an immunogen.	Human		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1319P	Neu-Oncogen (C-erb B2)	3B5	Tumour marker	3B5 is a mouse monoclonal antibody made by immunisation of Balb/c mice with a synthetitc peptide (TAENPEYLGLDVPV), corresponding to amino acids 1242-1255 of the C-terminal domain of human human c-erb B2 protein. This sequence is identical for the Rat Neu protein. ErbB-2 (also known as HER2/neu) stands for 'Human Epidermal growth factor Receptor 2' is a 185 kDa transmembrane tyrosine kinase, and is a protein giving higher aggressiveness in breast cancers. It is a member of the ErbB protein family, more commonly known as the epidermal growth factor receptor family. HER2/neu has also been designated as CD340 (cluster of differentiation 340) and p185. c-erb B2 expression is a prognostic indicator in breast carcinomas.	Human,Monkey,Mouse,Rat		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting	Cancer	None
MUB1316S	Neu-Oncogen (C-erb B2)	CB11	Tumour marker		Human		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1320P	Neu-Oncogen (C-erb B2)	9G6	Tumour marker	9G6 is a mouse monoclonal antibody made by immunisation of Balb/c mice with RAC311 cells transfected with SV40-neu construct, expressing high levels of human neu protein. ErbB-2 (also known as HER2/neu) stands for 'Human Epidermal growth factor Receptor 2' is a 185 kDa transmembrane tyrosine kinase, and is a protein giving higher aggressiveness in breast cancers. It is a member of the ErbB protein family, more commonly known as the epidermal growth factor receptor family. HER2/neu has also been designated as CD340 (cluster of differentiation 340) and p185. c-erb B2 expression is a prognostic indicator in breast carcinomas.	Human		Purified monoclonal antibody	Electron microscopy,Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting	Cancer	None
MUB1320S	Neu-Oncogen (C-erb B2)	9G6	Tumour marker	9G6 is a mouse monoclonal antibody made by immunisation of Balb/c mice with RAC311 cells transfected with SV40-neu construct, expressing high levels of human neu protein. ErbB-2 (also known as HER2/neu) stands for 'Human Epidermal growth factor Receptor 2' is a 185 kDa transmembrane tyrosine kinase, and is a protein giving higher aggressiveness in breast cancers. It is a member of the ErbB protein family, more commonly known as the epidermal growth factor receptor family. HER2/neu has also been designated as CD340 (cluster of differentiation 340) and p185. c-erb B2 expression is a prognostic indicator in breast carcinomas.	Human		Supernatant monoclonal antibody	Electron microscopy,Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting	Cancer	None
MUB1319S	Neu-Oncogen (C-erb B2)	3B5	Tumour marker	3B5 is a mouse monoclonal antibody made by immunisation of Balb/c mice with a synthetitc peptide (TAENPEYLGLDVPV), corresponding to amino acids 1242-1255 of the C-terminal domain of human human c-erb B2 protein. This sequence is identical for the Rat Neu protein. ErbB-2 (also known as HER2/neu) stands for 'Human Epidermal growth factor Receptor 2' is a 185 kDa transmembrane tyrosine kinase, and is a protein giving higher aggressiveness in breast cancers. It is a member of the ErbB protein family, more commonly known as the epidermal growth factor receptor family. HER2/neu has also been designated as CD340 (cluster of differentiation 340) and p185. c-erb B2 expression is a prognostic indicator in breast carcinomas.	Human,Monkey,Mouse,Rat		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting	Cancer	None
MUB1304S	Neurofilament 160 kD	RNF403	Cytoskeletal	RNF403 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue. RNF403 reacts exclusively with the phosphorylated isoform of the160 kD neurofilament protein.	Hamster,Human,Monkey,Xenopus		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1305P	Neurofilament 160 kD	RNF406	Cytoskeletal	RNF406 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue. RNF406 reacts exclusively with the phosphorylated isoform of the160 kD neurofilament protein.	Guinea Pig,Hamster,Human,Monkey,Rabbit,Xenopus		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1305S	Neurofilament 160 kD	RNF406	Cytoskeletal	RNF406 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue. RNF406 reacts exclusively with the phosphorylated isoform of the160 kD neurofilament protein.	Guinea Pig,Hamster,Human,Monkey,Rabbit,Xenopus		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1304P	Neurofilament 160 kD	RNF403	Cytoskeletal	RNF403 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue. RNF403 reacts exclusively with the phosphorylated isoform of the160 kD neurofilament protein.	Hamster,Human,Monkey,Xenopus		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1307P	Neurofilament 200 kD	RNF402	Cytoskeletal	RNF402 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue.RNF402 reacts with both the phosphorylated and non-phosphorylated isoform of the 200 kD neurofilament protein.	Bovine,Canine,Chicken,Guinea Pig,Hamster,Human,Monkey,Mouse,Rabbit,Rat,Sheep,Xenopus		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1308S	Neurofilament 200 kD	RNF405	Cytoskeletal	RNF405 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue. RNF405 reacts exclusively with the phosphorylated isoform of the 200 kD neurofilament protein.	Bovine,Canine,Chicken,Guinea Pig,Hamster,Human,Monkey,Mouse,Rabbit,Rat,Sheep,Xenopus		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1308P	Neurofilament 200 kD	RNF405	Cytoskeletal	RNF405 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue. RNF405 reacts exclusively with the phosphorylated isoform of the 200 kD neurofilament protein.	Bovine,Canine,Chicken,Guinea Pig,Hamster,Human,Monkey,Mouse,Rabbit,Rat,Sheep,Xenopus		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1306S	Neurofilament 200 kD	RNF404	Cytoskeletal	RNF404 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue. RNF404 reacts exclusively with the phosphorylated isoform of the 200 kD neurofilament protein.	Bovine,Canine,Chicken,Guinea Pig,Human,Monkey,Mouse,Rabbit,Rat,Sheep,Xenopus		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1307S	Neurofilament 200 kD	RNF402	Cytoskeletal	RNF402 is a mouse monoclonal IgM antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue.RNF402 reacts with both the phosphorylated and non-phosphorylated isoform of the 200 kD neurofilament protein.	Bovine,Canine,Chicken,Guinea Pig,Hamster,Human,Monkey,Mouse,Rabbit,Rat,Sheep,Xenopus		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1306P	Neurofilament 200 kD	RNF404	Cytoskeletal	RNF404 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a neurofilament preparation of calf brain tissue. RNF404 reacts exclusively with the phosphorylated isoform of the 200 kD neurofilament protein.	Bovine,Canine,Chicken,Guinea Pig,Human,Monkey,Mouse,Rabbit,Rat,Sheep,Xenopus		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1303P	Neurofilament 70 kD	2F11	Cytoskeletal	2F11 is a mouse monoclonal IgG1, κ antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a human neurofilament preparation. 2F11 reacts exclusively with the phosphorylated isoform of the70 kD neurofilament protein.	Human		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB1303S	Neurofilament 70 kD	2F11	Cytoskeletal	2F11 is a mouse monoclonal IgG1, κ antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a human neurofilament preparation. 2F11 reacts exclusively with the phosphorylated isoform of the70 kD neurofilament protein.	Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cell differentiation,Cytoskeleton,Neurobiology,Stem cell research	None
MUB0306P	OB-Cadherin / Cadherin-11	16A	Cell adhesion	16A is a mouse monoclonal IgG1 antibody obtained by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with affinity purified extracellular domain of human cadherin-11- GST fusion protein. 16A recognizes the extracellular domain of cadherin-11.	Human,Rat		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell adhesion	None
MUB0306S	OB-Cadherin / Cadherin-11	16A	Cell adhesion	16A is a mouse monoclonal IgG1 antibody obtained by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with affinity purified extracellular domain of human cadherin-11- GST fusion protein. 16A recognizes the extracellular domain of cadherin-11.	Human,Rat		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cell adhesion	None
MUB1400S	Ovarian Cancer associated antigen	OVTL16	Tumour marker		Human		Supernatant monoclonal antibody	Immunohistochemistry frozen		None
MUB1500P	P53	Bp53.12	Cell cycle markers, Tumour marker	Bp53.12 is a mouse monoclonal IgG2a antibody derived by fusion of X63 Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with recombinant human wild-type p53 protein. Bp53.12 reacts with a denaturation-resistant epitope of p53.	Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer	None
MUB1500S	P53	Bp53.12	Cell cycle markers, Tumour marker	Bp53.12 is a mouse monoclonal IgG2a antibody derived by fusion of X63 Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with recombinant human wild-type p53 protein. Bp53.12 reacts with a denaturation-resistant epitope of p53.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer	None
MUB1506S	PCNA	PC10	Other		Human,Mouse,Rat,Zebrafish		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1503S	Plakophilin-3	23E3/4	Cell adhesion	23E3/4 is a mouse monoclonal IgG2b antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to amino acid residues 570-589 of human plakophilin-3 coupled to keyhole limpet hemocyanin via an additional cysteine residue at the N–terminus (CFTPQSRRLRELPLAADALTF). 23E3/4 reacts with an epitope located between residues 570-589 in human plakophilin-3.	Canine,Human,Mouse		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting	Cancer,Cell differentiation	None
MUB1502P	Plakophilin-3	12B11F8	Cell adhesion	12B11F8 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to amino acid residues 779-793 of human plakophilin-3 coupled to keyhole limpet hemocyanin. (KLHRDFRAKGYRKED). 12B11F8 reacts with an epitope located between residues 779-793 in human plakophilin-3.	Canine,Human,Mouse,Swine		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion,Cell differentiation	None
MUB1502S	Plakophilin-3	12B11F8	Cell adhesion	12B11F8 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to amino acid residues 779-793 of human plakophilin-3 coupled to keyhole limpet hemocyanin. (KLHRDFRAKGYRKED). 12B11F8 reacts with an epitope located between residues 779-793 in human plakophilin-3.	Canine,Human,Mouse,Swine		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Cell adhesion,Cell differentiation	None
MUB1503P	Plakophilin-3	23E3/4	Cell adhesion	23E3/4 is a mouse monoclonal IgG2b antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to amino acid residues 570-589 of human plakophilin-3 coupled to keyhole limpet hemocyanin via an additional cysteine residue at the N–terminus (CFTPQSRRLRELPLAADALTF). 23E3/4 reacts with an epitope located between residues 570-589 in human plakophilin-3.	Canine,Human,Mouse		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Immunoprecipitation,Western blotting	Cancer,Cell differentiation	None
MUB1512P	Plet-1	33A10	Other	33A10 is a rat monoclonal antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells of Sprague-Dawley rats immunized with mouse mammary tumor cells . The 33A10-defined antigen is the orphan protein, Placenta-expressed transcript (Plet)-1. 33A10 reactivity is identified in the developing mouse mammary gland, in the bronchioles of the lung, the salivary glands and the skin. Plet-1 is a product specific for keratinocytes undergoing terminal trichilemmal differentiation in the hair follicle and is expressed at the plasma membranes.	Mouse		Purified monoclonal antibody	Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Western blotting	Cell differentiation	None
MUB1512S	Plet-1	33A10	Other	33A10 is a rat monoclonal antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells of Sprague-Dawley rats immunized with mouse mammary tumor cells . The 33A10-defined antigen is the orphan protein, Placenta-expressed transcript (Plet)-1. 33A10 reactivity is identified in the developing mouse mammary gland, in the bronchioles of the lung, the salivary glands and the skin. Plet-1 is a product specific for keratinocytes undergoing terminal trichilemmal differentiation in the hair follicle and is expressed at the plasma membranes.	Mouse		Supernatant monoclonal antibody	Flow Cytometry,Immunofluorescence,Immunohistochemistry frozen ,Western blotting	Cell differentiation	None
MUB1510S	PSMA	107.1A4	Membrane, Tumour marker		Human		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1510P	PSMA	107.1A4	Membrane, Tumour marker		Human		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1812P	Rec.Pr.Thyrosin Phosphate (RPTP)	3G4	Cell adhesion	Mouse mAb 3G4 (IgG2b) was raised against the extracellular fibronectin type lli repeats of human RPTPu. RPTPm is a prototypic receptor-like protein-tyrosine phosphatase (RPTP) that mediates homotypic cell-cell interactions.	Human		Purified monoclonal antibody	Immunoprecipitation,Western blotting		None
MUB1811P	Rec.Pr.Thyrosin Phosphate (RPTP)	3D7	Cell adhesion	Monoclonal antibody 3D7 is directed against the extracellular domain of RPTPµ RPTPµ is a transmembrane protein tyrosine phosphatase with an adhesion molecule-like ectodomain. RPTPm is a prototypic receptor-like protein-tyrosine phosphatase (RPTP) that mediates homotypic cell-cell interactions. PTP mu is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP mu (MAM) domain, an Ig-like domain and four fibronectin type III-like repeats. This PTP has been shown to mediate cell-cell aggregation through the interaction with another molecule of this PTP on an adjacent cell. This PTP can interact with scaffolding protein RACK1/GNB2L1, which may be necessary for the downstream signaling in response to cell-cell adhesion.	Human,Rat,Swine		Purified monoclonal antibody	Flow Cytometry,Immunofluorescence,Immunoprecipitation,Western blotting		None
MUB1311P	Reticulon-1A / NSP-A	MON161	Membrane	MON-161 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a partially purified bacterially expressed Reticulon 1A (NSP-A) hybrid protein (β-GAL-NSP-A 6-776). MON-161 exclusively recognizes the 135 kD Reticulon-1A protein in immunoblots of NCI-H82 and other SCLC cell lines, and stains normal and pathological neural and neuroendocrine tissues. The epitope of MON-161 is located between amino acid residues 174-337 of Reticulon-1A.	Hamster,Human,Mouse,Rat		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1312P	Reticulon-1A / NSP-A	MON162	Membrane	MON-162 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a partially purified bacterially expressed Reticulon 1A (NSP-A) hybrid protein (β-GAL-NSP-A 6-776). MON-162 exclusively recognizes the 135 kD Reticulon-1A protein in immunoblots of NCI-H82 and other SCLC cell lines, and stains normal and pathological neural and neuroendocrine tissues. The epitope of MON-162 is located between amino acid residues 338-422 of Reticulon-1A.	Hamster,Human,Mouse,Rat		Purified monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1311S	Reticulon-1A / NSP-A	MON161	Membrane	MON-161 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a partially purified bacterially expressed Reticulon 1A (NSP-A) hybrid protein (β-GAL-NSP-A 6-776). MON-161 exclusively recognizes the 135 kD Reticulon-1A protein in immunoblots of NCI-H82 and other SCLC cell lines, and stains normal and pathological neural and neuroendocrine tissues. The epitope of MON-161 is located between amino acid residues 174-337 of Reticulon-1A.	Hamster,Human,Mouse,Rat		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1310S	Reticulon-1A / NSP-A	MON160	Membrane, Tumour marker	MON-160 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a partially purified bacterially expressed Reticulon 1A (NSP-A) hybrid protein (β-GAL-NSP-A 6-776). MON-160 exclusively recognizes the 135 kD Reticulon-1A protein in immunoblots of NCI-H82 and other SCLC cell lines, and stains normal and pathological neural and neuroendocrine tissues. The epitope of MON-160 is located between amino acid residues 174-337 of Reticulon-1A.	Hamster,Human,Mouse,Rat		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1312S	Reticulon-1A / NSP-A	MON162	Membrane	MON-162 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a partially purified bacterially expressed Reticulon 1A (NSP-A) hybrid protein (β-GAL-NSP-A 6-776). MON-162 exclusively recognizes the 135 kD Reticulon-1A protein in immunoblots of NCI-H82 and other SCLC cell lines, and stains normal and pathological neural and neuroendocrine tissues. The epitope of MON-162 is located between amino acid residues 338-422 of Reticulon-1A.	Hamster,Human,Mouse,Rat		Supernatant monoclonal antibody	Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1310P	Reticulon-1A / NSP-A	MON160	Membrane, Tumour marker	MON-160 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a mouse immunized with a partially purified bacterially expressed Reticulon 1A (NSP-A) hybrid protein (β-GAL-NSP-A 6-776). MON-160 exclusively recognizes the 135 kD Reticulon-1A protein in immunoblots of NCI-H82 and other SCLC cell lines, and stains normal and pathological neural and neuroendocrine tissues. The epitope of MON-160 is located between amino acid residues 174-337 of Reticulon-1A.	Hamster,Human,Mouse,Rat		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1314P	Reticulon-1A/B / NSP-A/B	RNL-3	Membrane	RNL-3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the small cell lung cancer cell line NCI-H82. RNL-3 recognizes an epitope located within the region of amino acids 421-589 of the neuro-endocrine specific protein Reticulon-1A (NSP-A), which is also present in the N-terminal part of Reticulon-1B (NSP-B).	Human,Monkey,Rabbit		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1313P	Reticulon-1A/B / NSP-A/B	RNL-2	Membrane	RNL-2 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the small cell lung cancer cell line NCI-H82. RNL-2 recognizes an epitope located within the region of amino acids 421-589 of the neuro-endocrine specific protein Reticulon-1A (NSP-A), which is also present in the N-terminal part of Reticulon-1B (NSP-B).	Human,Monkey,Rabbit		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1313S	Reticulon-1A/B / NSP-A/B	RNL-2	Membrane	RNL-2 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the small cell lung cancer cell line NCI-H82. RNL-2 recognizes an epitope located within the region of amino acids 421-589 of the neuro-endocrine specific protein Reticulon-1A (NSP-A), which is also present in the N-terminal part of Reticulon-1B (NSP-B).	Human,Monkey,Rabbit		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1314S	Reticulon-1A/B / NSP-A/B	RNL-3	Membrane	RNL-3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with the small cell lung cancer cell line NCI-H82. RNL-3 recognizes an epitope located within the region of amino acids 421-589 of the neuro-endocrine specific protein Reticulon-1A (NSP-A), which is also present in the N-terminal part of Reticulon-1B (NSP-B).	Human,Monkey,Rabbit		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Neurobiology	None
MUB1315S	Reticulon-1C / NSP-C	RNL-4	Membrane	RNL-4 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells, with spleen cells from a BALB/c mouse immunized with a synthetic peptide encompassing the unique 20 N-terminal amino acid sequence of Reticulon-1C. RNL-4 recognizes an epitope located within the first 20 amino acids of Reticulon-1C (NSP-C).	Human,Rat,Swine		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Neurobiology	None
MUB1315P	Reticulon-1C / NSP-C	RNL-4	Membrane	RNL-4 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells, with spleen cells from a BALB/c mouse immunized with a synthetic peptide encompassing the unique 20 N-terminal amino acid sequence of Reticulon-1C. RNL-4 recognizes an epitope located within the first 20 amino acids of Reticulon-1C (NSP-C).	Human,Rat,Swine		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Western blotting	Cancer,Neurobiology	None
MUB1700P	Smoothelin	R4A	Cytoskeletal	R4A is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal extract of chicken gizzard. R4A reacts with the 59 kDa and 100 kDa protein, corresponding to smoothelin A and B, respectively,which are exclusively found in smooth muscle cells.	Canine,Chicken,Feline,Human,Monkey,Swine		Purified monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton	None
MUB1700S	Smoothelin	R4A	Cytoskeletal	R4A is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a mouse immunized with a cytoskeletal extract of chicken gizzard. R4A reacts with the 59 kDa and 100 kDa protein, corresponding to smoothelin A and B, respectively,which are exclusively found in smooth muscle cells.	Canine,Chicken,Feline,Human,Monkey,Swine		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cardiovascular,Cell differentiation,Cytoskeleton	None
MUB1703S	Synaptophysin	SY38	Other		Bovine,Human,Mouse,Rat		Supernatant monoclonal antibody	Immunofluorescence,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting		None
MUB2005S	TBX-2	4D6	Tumour marker		Human		Supernatant monoclonal antibody	Immunoprecipitation,Western blotting		None
MUB2005P	TBX-2	4D6	Tumour marker		Human		Purified monoclonal antibody	Immunoprecipitation,Western blotting		None
MUB1809P	T-Cell Receptor	11F2	CD markers	11F2 (anti-TCR gamma delta-l) is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a Balb/c micee immunized with protein A-Sepharose/anti-CD3/antigen complex. Two types of T cell antigen receptors (TCRs) are now known, the alpha beta, and the gamma delta heterodimer, which are expressed at the cell surface in association with the CD3 molecular complex. In man and mouse, only a small part of the T lymphocytes of the peripheral blood (<5%) is gamma delta. Gamma delta T lymphocytes may complement alpha beta T cells in terms of antigenic specificities, functional capabilities, or sites of action within the body.	Human		Purified monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation	Cell adhesion,Immunology	None
MUB1809S	T-Cell Receptor	11F2	CD markers	11F2 (anti-TCR gamma delta-l) is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a Balb/c micee immunized with protein A-Sepharose/anti-CD3/antigen complex. Two types of T cell antigen receptors (TCRs) are now known, the alpha beta, and the gamma delta heterodimer, which are expressed at the cell surface in association with the CD3 molecular complex. In man and mouse, only a small part of the T lymphocytes of the peripheral blood (<5%) is gamma delta. Gamma delta T lymphocytes may complement alpha beta T cells in terms of antigenic specificities, functional capabilities, or sites of action within the body.	Human		Supernatant monoclonal antibody	Enzyme Linked Immuno Sorbent Assay,Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation	Cell adhesion,Immunology	None
MUB1802S	T-helper cell CD4	MEM115	CD markers		Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1806S	TIAM	F5S F6.2	Tumour marker	TIAM (T-lymphoma invasion and metastasis-inducing protein). TIAM-1 en -2 exists.	Human		Supernatant monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cancer,Immunology,Neurobiology	None
MUB1806P	TIAM	F5S F6.2	Tumour marker	TIAM (T-lymphoma invasion and metastasis-inducing protein). TIAM-1 en -2 exists.	Human		Purified monoclonal antibody	Immunohistochemistry frozen ,Western blotting	Cancer,Immunology,Neurobiology	None
MUB1808S	TIAM catalytic dom	poly	Other				Supernatant monoclonal antibody			None
MUB1807S	TIAM N terminal dom	poly	Other				Supernatant monoclonal antibody			None
MUB1813P	Transferrin Receptor (CD71)	66IG10	CD markers	66IG10 is a mouse monoclonal antibody made by immunisation of Balb/c mice with human T-cells. The antibody reacts with the transferrin receptor, a 180-190 kD transmembrane glycoprotein which exists as homodimeric type II membrane glycoprotein of 90-95 kDa with interchain disulfide bonds. Transferrin receptor is necessary for development of erythrocytes and the nervous system	Human		Purified monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Immunology	None
MUB1813S	Transferrin Receptor (CD71)	66IG10	CD markers	66IG10 is a mouse monoclonal antibody made by immunisation of Balb/c mice with human T-cells. The antibody reacts with the transferrin receptor, a 180-190 kD transmembrane glycoprotein which exists as homodimeric type II membrane glycoprotein of 90-95 kDa with interchain disulfide bonds. Transferrin receptor is necessary for development of erythrocytes and the nervous system	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation,Western blotting	Immunology	None
MUB1805S	TRH Poly	Polyclonal	Hormones		Human,Rat		Unpurified polyclonal antibody	Immunohistochemistry frozen ,Immunohistochemistry paraffin		None
MUB1905S	VCAM-1	4B9	Tumour marker	4B9 is a mouse IgG1 monoclonal antibody generated by immunization of Balb/c mice with human umbilical vein endothelium (HUVE) that were nonenzymatically harvested after stimulation for 24h with recombinant human (rh) TNF-a (10 ng/ml). The antibody binds the cytokine-induced endothelial cell adhesion protein, vascular cell adhesion molecule-1 (VCAM-1). VCAM-1 is induced on HUVE by tumor necrosis factor - alpha (TNF-a), rh IL-1 and LPS and interleukin-1 (IL-1) and is involved in adherence of lymphocytes cell lines. VCAM-1 is only minimally expressed on unstimulated endothelium. Molecular cloning and sequencing of VCAM-1 predicts a 69-kDa core protein with 6 potential N-linked glycosylation sites, if the protein is fully glycosylated a mature protein of abtou 90kDa is yielded. VCAM-1 mediates a component of the adherence of Peripheral Blood Lymphocytes (PBL) to rh TNF-stimulated HUVE, this CD18 independent mechanism of lymphocyte adherence to cytokine stimulated endothelium may be an important pathway of lymphocyte emigration at sites of inflammation and immune reaction.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunohistochemistry frozen ,Immunoprecipitation	Cancer,Immunology	None
MUB1900L2	Vimentin, labeled with Horse Radish Peroxidase	RV202	Cytoskeletal, Tumour marker		Canine,Chicken,Goat,Hamster,Human,Monkey,Mouse,Rat,Swine,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Immunology,Neurobiology,Stem cell research	Horse Radish Peroxidase
MUB1901S	Vimentin	RV203	Cytoskeletal	RV203 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytoskeletal vimentin extract of calf lens. RV203 reacts exclusively with vimentin, which is expressed in mesenchymal cells and mesenchymal derived tumors e.g. lymphoma, sarcoma and melanoma.	Canine,Goat,Hamster,Human,Rat,Swine		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Immunology,Neurobiology,Stem cell research	None
MUB1900P	Vimentin	RV202	Cytoskeletal, Tumour marker	RV202 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytoskeletal vimentin extract of calf lens. RV202 reacts exclusively with vimentin, which is expressed in mesenchymal cells and mesenchymal derived tumors e.g. lymphoma, sarcoma and melanoma.	Canine,Chicken,Goat,Hamster,Human,Monkey,Mouse,Rat,Swine,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Immunology,Neurobiology,Stem cell research	None
MUB1901P	Vimentin	RV203	Cytoskeletal	RV203 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytoskeletal vimentin extract of calf lens. RV203 reacts exclusively with vimentin, which is expressed in mesenchymal cells and mesenchymal derived tumors e.g. lymphoma, sarcoma and melanoma.	Canine,Goat,Hamster,Human,Rat,Swine		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Immunology,Neurobiology,Stem cell research	None
MUB1902P	Vimentin	V9	Cytoskeletal, Tumour marker	V9 is a mouse monoclonal IgG1 antibody derived by fusion of PAI mouse myeloma cells with spleen cells from a BALB/c mouse immunized with vimentin isolated from porcine lens. V9 reacts exclusively with vimentin, which is expressed in mesenchymal cells and mesenchymal derived tumors e.g. lymphoma, sarcoma and melanoma.	Chicken,Human,Rat,Sheep		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Immunology,Neurobiology,Stem cell research	None
MUB1902S	Vimentin	V9	Cytoskeletal, Tumour marker	V9 is a mouse monoclonal IgG1 antibody derived by fusion of PAI mouse myeloma cells with spleen cells from a BALB/c mouse immunized with vimentin isolated from porcine lens. V9 reacts exclusively with vimentin, which is expressed in mesenchymal cells and mesenchymal derived tumors e.g. lymphoma, sarcoma and melanoma.	Chicken,Human,Rat,Sheep		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Immunology,Neurobiology,Stem cell research	None
MUB1900L1	Vimentin, labeled with Fluorescein Isothiocyanate	RV202	Cytoskeletal, Tumour marker		Canine,Chicken,Goat,Human,Monkey,Mouse,Rat,Swine,Zebrafish		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Immunology,Neurobiology,Stem cell research	Fluorescein Isothiocyanate
MUB1900S	Vimentin	RV202	Cytoskeletal, Tumour marker	RV202 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a cytoskeletal vimentin extract of calf lens. RV202 reacts exclusively with vimentin, which is expressed in mesenchymal cells and mesenchymal derived tumors e.g. lymphoma, sarcoma and melanoma.	Canine,Chicken,Goat,Hamster,Human,Monkey,Mouse,Rat,Swine,Zebrafish		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunohistochemistry frozen ,Immunohistochemistry paraffin ,Western blotting	Cancer,Cytoskeleton,Immunology,Neurobiology,Stem cell research	None
MUB0707P	α-Glucosidase	43G7	Tumour marker	43G7 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a Balb/cHeA mouse hyperimmunized with purified acid alpha-glucosidase from human placenta. Acid alpha-glucosidase is a lysosomal enzyme that catalyzes the hydrolysis of the alpha -1,4 and alpha -1,6 linkages in glycogen, maltose, and isomaltose. Deficiency of acid alpha-glucosidase results in accumulation of glycogen (Pompe's Disease) within lysosomes, the two major tissues affected by this accumulation of glycogen are the cardiac and skeletal muscles.	Human		Purified monoclonal antibody	Western blotting		None
MUB0707S	α-Glucosidase	43G7	Tumour marker	43G7 is a mouse monoclonal IgG1 antibody derived by fusion of mouse myeloma cells with spleen cells from a Balb/cHeA mouse hyperimmunized with purified acid alpha-glucosidase from human placenta. Acid alpha-glucosidase is a lysosomal enzyme that catalyzes the hydrolysis of the alpha -1,4 and alpha -1,6 linkages in glycogen, maltose, and isomaltose. Deficiency of acid alpha-glucosidase results in accumulation of glycogen (Pompe's Disease) within lysosomes, the two major tissues affected by this accumulation of glycogen are the cardiac and skeletal muscles.	Human		Supernatant monoclonal antibody	Western blotting		None
MUB0311P	αT- catenin	892_24D2S	Cell adhesion	892-24D2S is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a C57Bl/6 mouse immunized with a synthetic peptide corresponding to amino acids 164-177 of the human αT-catenin protein including an additional N-terminal cysteine (CVANKSDLQKTYQKL) coupled to keyhole limpet hemocyanin. 892-24D2S reacts with an epitope located between residues 164-177 of the human αT catenin protein.	Human		Purified monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunoprecipitation,Western blotting	Cardiovascular,Cell adhesion	None
MUB0311S	αT- catenin	892_24D2S	Cell adhesion	892-24D2S is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0-Ag14 mouse myeloma cells with spleen cells from a C57Bl/6 mouse immunized with a synthetic peptide corresponding to amino acids 164-177 of the human αT-catenin protein including an additional N-terminal cysteine (CVANKSDLQKTYQKL) coupled to keyhole limpet hemocyanin. 892-24D2S reacts with an epitope located between residues 164-177 of the human αT catenin protein.	Human		Supernatant monoclonal antibody	Flow Cytometry,Immunocytochemistry,Immunoprecipitation,Western blotting	Cardiovascular,Cell adhesion	None

MUbio BV

Text search

Apply filters

Catalogue